Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JTJ3

Protein Details
Accession A0A4Z1JTJ3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-26FSWIFEKGRRGKYKTEKERGLDCRHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, mito 3, cyto 2, golg 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MSFSWIFEKGRRGKYKTEKERGLDCRYPNAIQSTLPDRPISPIMKVMPHSLGAVLGYVVLVCKRHNHRPASSTSNYILSGDMTIAFGAFAHTRCHDEDILGFCIDTVDSPRAQGRRFAAGPNGQMVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.81
4 0.82
5 0.79
6 0.75
7 0.8
8 0.77
9 0.75
10 0.7
11 0.61
12 0.58
13 0.54
14 0.5
15 0.43
16 0.4
17 0.32
18 0.26
19 0.28
20 0.27
21 0.26
22 0.27
23 0.24
24 0.21
25 0.23
26 0.27
27 0.25
28 0.19
29 0.21
30 0.21
31 0.23
32 0.24
33 0.22
34 0.19
35 0.18
36 0.17
37 0.13
38 0.11
39 0.09
40 0.08
41 0.05
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.1
50 0.15
51 0.24
52 0.31
53 0.35
54 0.38
55 0.41
56 0.45
57 0.47
58 0.44
59 0.39
60 0.33
61 0.3
62 0.27
63 0.24
64 0.19
65 0.12
66 0.1
67 0.08
68 0.07
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.09
78 0.1
79 0.13
80 0.14
81 0.18
82 0.17
83 0.16
84 0.18
85 0.2
86 0.21
87 0.19
88 0.18
89 0.14
90 0.14
91 0.13
92 0.11
93 0.11
94 0.11
95 0.11
96 0.13
97 0.19
98 0.22
99 0.24
100 0.29
101 0.29
102 0.34
103 0.36
104 0.37
105 0.39
106 0.41
107 0.41