Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JMA1

Protein Details
Accession A0A4Z1JMA1    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
206-248KQEAIKRLKEERKAKKKAEKADLLELSKKRKKKHVSLNGLTSLHydrophilic
NLS Segment(s)
PositionSequence
205-239SKQEAIKRLKEERKAKKKAEKADLLELSKKRKKKH
285-299RKHQGDGGPPRKSQR
Subcellular Location(s) nucl 13.5mito_nucl 13.5, mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSASAGTPTSAPKAMSSRLLTMKFMQRAAASSPTNTSPSSIDEPSPKRQKTAQNTPTKFNVDTLADNRAIQAAIVEEEAKKQAALDRAAVEAGDTRWVLSFEGRKHLNTPTNTLRVVQTGFANLDQPSPIKAERVDDDDNNFGEEKPFMVGRRSFGKFNKVLEKQQNPDIEFTSSEEDEESEEEESEDEDSEDDPTGAKELIKASKQEAIKRLKEERKAKKKAEKADLLELSKKRKKKHVSLNGLTSLSGSGGGSFGSGGGIKSDIKCYTCGGNHMARDCSNPKRKHQGDGGPPRKSQRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.32
4 0.35
5 0.39
6 0.41
7 0.4
8 0.41
9 0.47
10 0.44
11 0.41
12 0.37
13 0.31
14 0.32
15 0.33
16 0.34
17 0.27
18 0.25
19 0.27
20 0.27
21 0.29
22 0.27
23 0.24
24 0.19
25 0.23
26 0.26
27 0.25
28 0.25
29 0.32
30 0.36
31 0.45
32 0.53
33 0.49
34 0.48
35 0.53
36 0.6
37 0.61
38 0.68
39 0.68
40 0.69
41 0.71
42 0.72
43 0.71
44 0.65
45 0.56
46 0.46
47 0.4
48 0.31
49 0.32
50 0.29
51 0.28
52 0.25
53 0.24
54 0.23
55 0.19
56 0.17
57 0.12
58 0.1
59 0.07
60 0.06
61 0.07
62 0.08
63 0.07
64 0.08
65 0.1
66 0.09
67 0.08
68 0.08
69 0.12
70 0.16
71 0.17
72 0.18
73 0.18
74 0.18
75 0.18
76 0.17
77 0.14
78 0.1
79 0.09
80 0.09
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.11
87 0.16
88 0.16
89 0.23
90 0.24
91 0.24
92 0.26
93 0.32
94 0.35
95 0.32
96 0.36
97 0.35
98 0.37
99 0.37
100 0.35
101 0.3
102 0.25
103 0.24
104 0.19
105 0.13
106 0.11
107 0.12
108 0.11
109 0.12
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.1
119 0.12
120 0.13
121 0.18
122 0.2
123 0.18
124 0.2
125 0.21
126 0.2
127 0.19
128 0.18
129 0.12
130 0.1
131 0.1
132 0.08
133 0.07
134 0.08
135 0.07
136 0.1
137 0.11
138 0.13
139 0.19
140 0.21
141 0.23
142 0.24
143 0.31
144 0.3
145 0.32
146 0.39
147 0.36
148 0.4
149 0.45
150 0.48
151 0.44
152 0.47
153 0.48
154 0.4
155 0.38
156 0.33
157 0.26
158 0.22
159 0.2
160 0.18
161 0.13
162 0.12
163 0.11
164 0.1
165 0.09
166 0.09
167 0.09
168 0.06
169 0.06
170 0.06
171 0.06
172 0.06
173 0.06
174 0.06
175 0.05
176 0.05
177 0.05
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.07
185 0.06
186 0.07
187 0.1
188 0.15
189 0.16
190 0.18
191 0.18
192 0.24
193 0.27
194 0.3
195 0.35
196 0.39
197 0.42
198 0.46
199 0.54
200 0.56
201 0.62
202 0.67
203 0.71
204 0.74
205 0.79
206 0.82
207 0.82
208 0.82
209 0.82
210 0.82
211 0.79
212 0.72
213 0.72
214 0.68
215 0.62
216 0.61
217 0.55
218 0.55
219 0.54
220 0.54
221 0.51
222 0.56
223 0.63
224 0.66
225 0.74
226 0.75
227 0.79
228 0.81
229 0.82
230 0.77
231 0.68
232 0.57
233 0.46
234 0.35
235 0.24
236 0.18
237 0.11
238 0.06
239 0.05
240 0.05
241 0.05
242 0.05
243 0.04
244 0.05
245 0.05
246 0.05
247 0.06
248 0.07
249 0.09
250 0.11
251 0.15
252 0.17
253 0.18
254 0.2
255 0.21
256 0.26
257 0.26
258 0.28
259 0.29
260 0.32
261 0.35
262 0.37
263 0.39
264 0.34
265 0.39
266 0.42
267 0.47
268 0.51
269 0.54
270 0.59
271 0.67
272 0.69
273 0.7
274 0.73
275 0.72
276 0.73
277 0.78
278 0.79
279 0.74
280 0.75
281 0.74