Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JS02

Protein Details
Accession A0A4Z1JS02    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
271-297GKVVKEPKVQAMRRRKRQIRDLEAYSGHydrophilic
NLS Segment(s)
PositionSequence
283-286RRRK
Subcellular Location(s) nucl 14.5, mito_nucl 11, mito 6.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MSSITNVMRLLNNVITGEYPEYLPRSSAEVITLLGGLKSREEVYLSHYRRMKGVTNHELKRVYDFVAASIVMVTDITKELMELASIDSRVKSFHVYEALRILYLAFGAFQRLAGKVKTLPQPEKDRCFGYVGGCYNYSILFQKLLYPEDECDHLEIYAQALRHDFQFCFKIDTDQDYSSPGSSLRNGFEKTLSACIPPANQIPVYCHLTAQPDKPVCPQFYRNPYFYGPRNLRNQNHESNRDYFKMKEDRERGVYRTKAATTSDISYNHGGKVVKEPKVQAMRRRKRQIRDLEAYSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.16
4 0.17
5 0.14
6 0.13
7 0.14
8 0.17
9 0.17
10 0.17
11 0.16
12 0.19
13 0.19
14 0.19
15 0.18
16 0.16
17 0.15
18 0.15
19 0.15
20 0.1
21 0.09
22 0.09
23 0.08
24 0.08
25 0.1
26 0.1
27 0.1
28 0.11
29 0.11
30 0.18
31 0.28
32 0.3
33 0.36
34 0.39
35 0.39
36 0.4
37 0.44
38 0.44
39 0.42
40 0.49
41 0.52
42 0.57
43 0.59
44 0.62
45 0.61
46 0.54
47 0.51
48 0.42
49 0.34
50 0.28
51 0.25
52 0.2
53 0.19
54 0.18
55 0.13
56 0.11
57 0.09
58 0.06
59 0.06
60 0.05
61 0.04
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.05
70 0.06
71 0.07
72 0.08
73 0.09
74 0.09
75 0.09
76 0.1
77 0.1
78 0.11
79 0.11
80 0.13
81 0.19
82 0.19
83 0.2
84 0.22
85 0.22
86 0.19
87 0.18
88 0.15
89 0.08
90 0.08
91 0.07
92 0.04
93 0.04
94 0.05
95 0.05
96 0.06
97 0.07
98 0.08
99 0.1
100 0.09
101 0.11
102 0.12
103 0.18
104 0.24
105 0.29
106 0.31
107 0.36
108 0.46
109 0.5
110 0.53
111 0.5
112 0.45
113 0.4
114 0.39
115 0.33
116 0.25
117 0.23
118 0.2
119 0.19
120 0.18
121 0.17
122 0.14
123 0.13
124 0.13
125 0.09
126 0.08
127 0.07
128 0.07
129 0.1
130 0.11
131 0.12
132 0.12
133 0.11
134 0.12
135 0.12
136 0.13
137 0.11
138 0.1
139 0.09
140 0.09
141 0.08
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.07
148 0.08
149 0.09
150 0.11
151 0.1
152 0.11
153 0.14
154 0.14
155 0.17
156 0.17
157 0.18
158 0.17
159 0.21
160 0.23
161 0.21
162 0.2
163 0.19
164 0.19
165 0.16
166 0.16
167 0.12
168 0.1
169 0.11
170 0.12
171 0.12
172 0.16
173 0.17
174 0.17
175 0.18
176 0.18
177 0.17
178 0.19
179 0.18
180 0.14
181 0.14
182 0.14
183 0.14
184 0.15
185 0.15
186 0.14
187 0.15
188 0.15
189 0.17
190 0.21
191 0.25
192 0.22
193 0.21
194 0.2
195 0.25
196 0.27
197 0.26
198 0.3
199 0.27
200 0.29
201 0.34
202 0.38
203 0.35
204 0.37
205 0.41
206 0.42
207 0.5
208 0.54
209 0.5
210 0.48
211 0.48
212 0.49
213 0.47
214 0.49
215 0.44
216 0.46
217 0.53
218 0.58
219 0.6
220 0.63
221 0.65
222 0.65
223 0.68
224 0.67
225 0.63
226 0.6
227 0.59
228 0.54
229 0.5
230 0.41
231 0.41
232 0.45
233 0.44
234 0.49
235 0.49
236 0.52
237 0.57
238 0.6
239 0.55
240 0.55
241 0.54
242 0.48
243 0.48
244 0.43
245 0.38
246 0.37
247 0.37
248 0.31
249 0.32
250 0.32
251 0.29
252 0.31
253 0.32
254 0.31
255 0.28
256 0.29
257 0.26
258 0.22
259 0.32
260 0.36
261 0.38
262 0.41
263 0.43
264 0.48
265 0.58
266 0.63
267 0.63
268 0.66
269 0.71
270 0.78
271 0.86
272 0.86
273 0.86
274 0.89
275 0.9
276 0.89
277 0.87