Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JNP4

Protein Details
Accession A0A4Z1JNP4   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
86-125RAKQTRAIRRRLSKHEKELQLEKTKKRSMHFPQRKFAVKAHydrophilic
NLS Segment(s)
PositionSequence
87-114AKQTRAIRRRLSKHEKELQLEKTKKRSM
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKTGQLWSKNKADLAKQLGELKTELGQLRTQKIAGGSAAKLTKIHDVRKSIAKVLTVINANQRAQLRLFYKGKKYLPLDLRAKQTRAIRRRLSKHEKELQLEKTKKRSMHFPQRKFAVKAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.58
3 0.53
4 0.48
5 0.47
6 0.44
7 0.41
8 0.38
9 0.41
10 0.39
11 0.36
12 0.33
13 0.26
14 0.21
15 0.22
16 0.2
17 0.16
18 0.19
19 0.21
20 0.23
21 0.23
22 0.21
23 0.19
24 0.18
25 0.18
26 0.15
27 0.14
28 0.12
29 0.14
30 0.15
31 0.14
32 0.14
33 0.14
34 0.2
35 0.22
36 0.27
37 0.28
38 0.31
39 0.33
40 0.4
41 0.4
42 0.35
43 0.33
44 0.28
45 0.25
46 0.22
47 0.22
48 0.16
49 0.15
50 0.16
51 0.18
52 0.17
53 0.19
54 0.19
55 0.17
56 0.17
57 0.21
58 0.18
59 0.23
60 0.27
61 0.28
62 0.33
63 0.38
64 0.39
65 0.42
66 0.43
67 0.44
68 0.45
69 0.49
70 0.5
71 0.48
72 0.55
73 0.53
74 0.51
75 0.48
76 0.5
77 0.52
78 0.53
79 0.58
80 0.58
81 0.63
82 0.71
83 0.76
84 0.79
85 0.78
86 0.81
87 0.81
88 0.78
89 0.75
90 0.74
91 0.72
92 0.72
93 0.7
94 0.68
95 0.67
96 0.67
97 0.66
98 0.62
99 0.64
100 0.64
101 0.68
102 0.72
103 0.71
104 0.74
105 0.78
106 0.82
107 0.75