Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1K6P3

Protein Details
Accession A0A4Z1K6P3   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
60-86DMTPEPRKKELEKKKKVQRNDDIKLCVHydrophilic
NLS Segment(s)
PositionSequence
66-75RKKELEKKKK
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MGLLTCPMFASSALRIEGPMIVRVAKYMCPTHDFRGVYDRNLVKMVEERKTGGSWFDPPDMTPEPRKKELEKKKKVQRNDDIKLCVTM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.14
4 0.16
5 0.14
6 0.14
7 0.11
8 0.11
9 0.11
10 0.12
11 0.13
12 0.13
13 0.15
14 0.15
15 0.16
16 0.2
17 0.24
18 0.26
19 0.32
20 0.3
21 0.27
22 0.34
23 0.33
24 0.3
25 0.33
26 0.3
27 0.24
28 0.25
29 0.24
30 0.16
31 0.19
32 0.21
33 0.18
34 0.18
35 0.18
36 0.18
37 0.19
38 0.19
39 0.15
40 0.14
41 0.14
42 0.16
43 0.17
44 0.16
45 0.15
46 0.2
47 0.23
48 0.24
49 0.29
50 0.34
51 0.39
52 0.45
53 0.49
54 0.5
55 0.57
56 0.66
57 0.69
58 0.72
59 0.76
60 0.81
61 0.86
62 0.89
63 0.88
64 0.88
65 0.87
66 0.86
67 0.83
68 0.78