FuNGI

A0A4Z1KCJ6

Protein Details

Accession

A0A4Z1KCJ6

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
10-35	YLLPLDTPSKNQRRRYKDHLTCLPLL	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 9, cyto 6.5, plas 5, cyto_nucl 4, E.R. 4

Family & Domain DBs

InterPro	View protein in InterPro IPR029149 Creatin/AminoP/Spt16_NTD IPR036005 Creatinase/aminopeptidase-like IPR000587 Creatinase_N IPR000994 Pept_M24
Gene Ontology	GO:0016020 C:membrane GO:0016787 F:hydrolase activity
Pfam	View protein in Pfam PF01321 Creatinase_N PF00557 Peptidase_M24

Amino Acid Sequences

MALEKDMREYLLPLDTPSKNQRRRYKDHLTCLPLLASALFVAMVITYFSSQSIHRHREFQLTSESLHECAWSHLEKYEQLLNVEPIAREEFLERQRVLAGVLEKDGVDAFIAEPSASTEYFGNVSSAFELSERPFLVILDKEGAATLLVPKFERGRIGALDMVFEEGTKRIVEWREEENPYEVLRREMGLKKVVLDEHVRFMVAAGLQDVGVDVQLMSLEMKELRAVKSETELDILRGVNEFTVQLVRSLQKCIKVGMSQESIVEAAESLFTQAGVGAGFWSIVLFGEQAANPHGGGKGRILRDGEFVLVDIGTSLHGYGSDVTRTILPSTSTVDQELMDIWHLVYDAQSAAIEKMNINETCSVVDETARNVIKAKGYGEFFTHRLGHGLGLEMHEHPYLNGVNGEKLKKGEVVTNEPGIYITSSQATKLGKKVGFGVRIEDAVLVTEKGGRVMTGSRAKSPYEP

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.26
2	0.26
3	0.32
4	0.41
5	0.5
6	0.54
7	0.63
8	0.71
9	0.73
10	0.8
11	0.83
12	0.84
13	0.83
14	0.85
15	0.84
16	0.81
17	0.73
18	0.67
19	0.58
20	0.47
21	0.37
22	0.27
23	0.18
24	0.11
25	0.08
26	0.06
27	0.05
28	0.05
29	0.04
30	0.04
31	0.04
32	0.05
33	0.05
34	0.06
35	0.06
36	0.08
37	0.09
38	0.18
39	0.27
40	0.35
41	0.37
42	0.42
43	0.45
44	0.53
45	0.53
46	0.48
47	0.46
48	0.4
49	0.38
50	0.37
51	0.35
52	0.27
53	0.25
54	0.23
55	0.15
56	0.16
57	0.19
58	0.16
59	0.16
60	0.17
61	0.19
62	0.2
63	0.22
64	0.26
65	0.23
66	0.23
67	0.24
68	0.23
69	0.23
70	0.24
71	0.2
72	0.17
73	0.18
74	0.17
75	0.15
76	0.16
77	0.2
78	0.22
79	0.28
80	0.26
81	0.25
82	0.25
83	0.25
84	0.23
85	0.2
86	0.19
87	0.14
88	0.14
89	0.14
90	0.13
91	0.13
92	0.13
93	0.09
94	0.06
95	0.06
96	0.05
97	0.05
98	0.06
99	0.05
100	0.05
101	0.07
102	0.09
103	0.08
104	0.09
105	0.09
106	0.09
107	0.11
108	0.11
109	0.1
110	0.08
111	0.09
112	0.08
113	0.08
114	0.08
115	0.07
116	0.09
117	0.1
118	0.13
119	0.12
120	0.12
121	0.12
122	0.12
123	0.14
124	0.13
125	0.13
126	0.12
127	0.11
128	0.11
129	0.11
130	0.11
131	0.08
132	0.07
133	0.09
134	0.09
135	0.09
136	0.1
137	0.11
138	0.13
139	0.14
140	0.16
141	0.14
142	0.15
143	0.15
144	0.17
145	0.18
146	0.16
147	0.15
148	0.13
149	0.13
150	0.1
151	0.09
152	0.08
153	0.06
154	0.07
155	0.07
156	0.07
157	0.1
158	0.13
159	0.15
160	0.17
161	0.22
162	0.28
163	0.29
164	0.3
165	0.28
166	0.27
167	0.25
168	0.25
169	0.2
170	0.15
171	0.14
172	0.13
173	0.16
174	0.19
175	0.21
176	0.22
177	0.22
178	0.22
179	0.23
180	0.23
181	0.2
182	0.2
183	0.18
184	0.17
185	0.17
186	0.16
187	0.14
188	0.13
189	0.12
190	0.09
191	0.08
192	0.05
193	0.06
194	0.05
195	0.05
196	0.05
197	0.04
198	0.03
199	0.03
200	0.02
201	0.02
202	0.02
203	0.03
204	0.03
205	0.03
206	0.03
207	0.03
208	0.04
209	0.05
210	0.07
211	0.07
212	0.1
213	0.11
214	0.11
215	0.13
216	0.14
217	0.13
218	0.14
219	0.13
220	0.11
221	0.12
222	0.11
223	0.09
224	0.08
225	0.08
226	0.06
227	0.06
228	0.05
229	0.04
230	0.06
231	0.05
232	0.06
233	0.07
234	0.1
235	0.11
236	0.15
237	0.16
238	0.19
239	0.2
240	0.2
241	0.2
242	0.19
243	0.2
244	0.21
245	0.21
246	0.18
247	0.17
248	0.16
249	0.14
250	0.12
251	0.1
252	0.06
253	0.04
254	0.04
255	0.04
256	0.04
257	0.04
258	0.03
259	0.03
260	0.03
261	0.04
262	0.03
263	0.03
264	0.03
265	0.03
266	0.03
267	0.03
268	0.03
269	0.03
270	0.03
271	0.03
272	0.03
273	0.03
274	0.05
275	0.05
276	0.06
277	0.07
278	0.08
279	0.07
280	0.08
281	0.09
282	0.09
283	0.09
284	0.12
285	0.17
286	0.17
287	0.21
288	0.21
289	0.21
290	0.22
291	0.22
292	0.19
293	0.13
294	0.12
295	0.1
296	0.08
297	0.07
298	0.05
299	0.04
300	0.04
301	0.04
302	0.04
303	0.03
304	0.04
305	0.04
306	0.06
307	0.07
308	0.07
309	0.08
310	0.08
311	0.09
312	0.1
313	0.11
314	0.11
315	0.11
316	0.11
317	0.15
318	0.16
319	0.16
320	0.16
321	0.16
322	0.14
323	0.14
324	0.13
325	0.1
326	0.08
327	0.08
328	0.07
329	0.06
330	0.06
331	0.06
332	0.05
333	0.06
334	0.05
335	0.05
336	0.06
337	0.06
338	0.07
339	0.08
340	0.09
341	0.08
342	0.1
343	0.16
344	0.16
345	0.17
346	0.17
347	0.17
348	0.17
349	0.19
350	0.18
351	0.12
352	0.14
353	0.13
354	0.13
355	0.2
356	0.19
357	0.18
358	0.18
359	0.2
360	0.21
361	0.23
362	0.23
363	0.21
364	0.22
365	0.23
366	0.25
367	0.27
368	0.25
369	0.27
370	0.27
371	0.22
372	0.22
373	0.21
374	0.18
375	0.15
376	0.16
377	0.13
378	0.13
379	0.15
380	0.13
381	0.15
382	0.14
383	0.14
384	0.11
385	0.14
386	0.13
387	0.13
388	0.15
389	0.14
390	0.19
391	0.24
392	0.26
393	0.25
394	0.25
395	0.26
396	0.26
397	0.27
398	0.28
399	0.29
400	0.35
401	0.37
402	0.39
403	0.37
404	0.34
405	0.33
406	0.28
407	0.23
408	0.16
409	0.13
410	0.13
411	0.14
412	0.14
413	0.18
414	0.21
415	0.23
416	0.27
417	0.34
418	0.32
419	0.33
420	0.4
421	0.44
422	0.46
423	0.43
424	0.43
425	0.36
426	0.36
427	0.35
428	0.27
429	0.2
430	0.15
431	0.16
432	0.11
433	0.1
434	0.12
435	0.12
436	0.13
437	0.13
438	0.11
439	0.12
440	0.15
441	0.23
442	0.29
443	0.31
444	0.36
445	0.39

A0A4Z1KCJ6

3D AlphaFold-predicted Structure Viewer