Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DYN7

Protein Details
Accession A5DYN7    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
123-143LHLHKQRRKSLKQLQNRHKSLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12mito 12mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019258  Mediator_Med4  
Gene Ontology GO:0016592  C:mediator complex  
GO:0003712  F:transcription coregulator activity  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG lel:LELG_02474  -  
Pfam View protein in Pfam  
PF10018  Med4  
Amino Acid Sequences MLPYRRPDSPLLSSLISRTASATKLNQLYQDSATRSATATPSAYVTSSLNPARNVPILDSSSRFQNGNPSIDSLPVISHIDEFRALLDELSEAVTLFKDDEVFTKFEKLTKLNTTIENDIKELHLHKQRRKSLKQLQNRHKSLDDLQKNTLKKLLSYRSELRKLPRAKTYELKQDKDNDPNSLKIDVKDIFAYSMKLAKFSKAPVAMGNLSHQIHPNNYIWPAEDSLRRGMLAMSYIQEKEILENVLGEEKPVSVAKEETSKENSERVSILPSKESGDTSLNGTPHPSNRDHIEIAPTAPTAPTAVDEDENGYSNEVADLDLDLFDPDAELSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.27
4 0.22
5 0.21
6 0.2
7 0.2
8 0.23
9 0.25
10 0.28
11 0.32
12 0.33
13 0.35
14 0.35
15 0.36
16 0.35
17 0.37
18 0.32
19 0.31
20 0.31
21 0.27
22 0.25
23 0.25
24 0.23
25 0.2
26 0.18
27 0.16
28 0.16
29 0.16
30 0.16
31 0.15
32 0.15
33 0.14
34 0.19
35 0.22
36 0.23
37 0.24
38 0.25
39 0.27
40 0.28
41 0.27
42 0.23
43 0.24
44 0.24
45 0.25
46 0.26
47 0.24
48 0.26
49 0.27
50 0.25
51 0.21
52 0.28
53 0.3
54 0.31
55 0.3
56 0.29
57 0.28
58 0.28
59 0.28
60 0.19
61 0.15
62 0.13
63 0.13
64 0.1
65 0.11
66 0.11
67 0.11
68 0.11
69 0.11
70 0.1
71 0.11
72 0.11
73 0.09
74 0.09
75 0.08
76 0.08
77 0.08
78 0.08
79 0.05
80 0.05
81 0.06
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.08
88 0.11
89 0.13
90 0.13
91 0.17
92 0.17
93 0.19
94 0.22
95 0.22
96 0.24
97 0.27
98 0.31
99 0.3
100 0.33
101 0.33
102 0.35
103 0.35
104 0.31
105 0.27
106 0.23
107 0.2
108 0.19
109 0.17
110 0.19
111 0.25
112 0.31
113 0.37
114 0.46
115 0.54
116 0.63
117 0.66
118 0.69
119 0.72
120 0.74
121 0.78
122 0.79
123 0.82
124 0.82
125 0.8
126 0.73
127 0.63
128 0.56
129 0.52
130 0.52
131 0.47
132 0.39
133 0.41
134 0.44
135 0.43
136 0.41
137 0.38
138 0.28
139 0.24
140 0.27
141 0.3
142 0.28
143 0.33
144 0.39
145 0.43
146 0.47
147 0.48
148 0.45
149 0.47
150 0.48
151 0.47
152 0.47
153 0.43
154 0.42
155 0.46
156 0.47
157 0.49
158 0.5
159 0.49
160 0.45
161 0.48
162 0.48
163 0.49
164 0.46
165 0.4
166 0.35
167 0.35
168 0.34
169 0.3
170 0.27
171 0.2
172 0.22
173 0.18
174 0.18
175 0.16
176 0.14
177 0.13
178 0.12
179 0.13
180 0.1
181 0.13
182 0.12
183 0.14
184 0.15
185 0.15
186 0.16
187 0.17
188 0.21
189 0.18
190 0.19
191 0.17
192 0.2
193 0.2
194 0.19
195 0.19
196 0.18
197 0.17
198 0.17
199 0.18
200 0.16
201 0.16
202 0.19
203 0.19
204 0.17
205 0.17
206 0.17
207 0.16
208 0.17
209 0.17
210 0.16
211 0.18
212 0.18
213 0.19
214 0.19
215 0.17
216 0.16
217 0.14
218 0.12
219 0.11
220 0.1
221 0.09
222 0.1
223 0.1
224 0.1
225 0.11
226 0.11
227 0.11
228 0.12
229 0.11
230 0.09
231 0.1
232 0.1
233 0.13
234 0.12
235 0.11
236 0.09
237 0.09
238 0.1
239 0.11
240 0.11
241 0.09
242 0.11
243 0.12
244 0.19
245 0.2
246 0.23
247 0.26
248 0.29
249 0.29
250 0.32
251 0.31
252 0.26
253 0.26
254 0.23
255 0.25
256 0.25
257 0.25
258 0.24
259 0.24
260 0.25
261 0.25
262 0.24
263 0.21
264 0.2
265 0.19
266 0.2
267 0.23
268 0.21
269 0.2
270 0.23
271 0.23
272 0.25
273 0.3
274 0.28
275 0.28
276 0.32
277 0.37
278 0.37
279 0.35
280 0.35
281 0.31
282 0.3
283 0.27
284 0.23
285 0.18
286 0.16
287 0.15
288 0.1
289 0.09
290 0.1
291 0.11
292 0.13
293 0.13
294 0.14
295 0.16
296 0.17
297 0.18
298 0.16
299 0.15
300 0.13
301 0.12
302 0.12
303 0.09
304 0.08
305 0.07
306 0.08
307 0.07
308 0.07
309 0.08
310 0.07
311 0.07
312 0.07
313 0.07