Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1IZ84

Protein Details
Accession A0A4Z1IZ84    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
25-44EEKKEKEKEKENDKNKKKEEBasic
NLS Segment(s)
PositionSequence
26-43EKKEKEKEKENDKNKKKE
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MYLVPAGWVGSSLNERLMKESKEEEEKKEKEKEKENDKNKKKEEEEEQKDTKERSSKRENQESISSFPRPVNLPIY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.26
5 0.25
6 0.26
7 0.29
8 0.28
9 0.35
10 0.37
11 0.39
12 0.44
13 0.47
14 0.49
15 0.54
16 0.57
17 0.53
18 0.6
19 0.62
20 0.63
21 0.7
22 0.74
23 0.76
24 0.78
25 0.82
26 0.76
27 0.76
28 0.67
29 0.63
30 0.63
31 0.64
32 0.62
33 0.61
34 0.59
35 0.53
36 0.54
37 0.49
38 0.43
39 0.41
40 0.37
41 0.38
42 0.46
43 0.53
44 0.6
45 0.69
46 0.67
47 0.64
48 0.69
49 0.64
50 0.58
51 0.54
52 0.46
53 0.38
54 0.36
55 0.34
56 0.29