Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1J9W1

Protein Details
Accession A0A4Z1J9W1   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
73-100VYQKPWPWQRTKPKTKPKVTPRPCPYPEHydrophilic
NLS Segment(s)
Subcellular Location(s) golg 8, extr 6, mito 5, E.R. 5, plas 2
Family & Domain DBs
Amino Acid Sequences MKVSKAYVFVLITFFNLNTAAVIPETTTIDGNLVPFNMTTPEIPPPFVVLSSPPSPTKTKRDEAKESYRIVHVYQKPWPWQRTKPKTKPKVTPRPCPYPETRPCITQKEIDQGWHDKAGCYSRSLFFTWGSTHCWDAGDDCVKSDCRY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.11
4 0.1
5 0.08
6 0.09
7 0.08
8 0.07
9 0.07
10 0.07
11 0.08
12 0.09
13 0.1
14 0.09
15 0.09
16 0.09
17 0.09
18 0.1
19 0.09
20 0.08
21 0.08
22 0.07
23 0.08
24 0.09
25 0.09
26 0.09
27 0.1
28 0.16
29 0.16
30 0.17
31 0.16
32 0.17
33 0.16
34 0.16
35 0.14
36 0.1
37 0.14
38 0.15
39 0.17
40 0.16
41 0.19
42 0.23
43 0.27
44 0.33
45 0.35
46 0.4
47 0.45
48 0.52
49 0.56
50 0.6
51 0.64
52 0.62
53 0.57
54 0.51
55 0.45
56 0.38
57 0.32
58 0.33
59 0.27
60 0.24
61 0.27
62 0.29
63 0.34
64 0.4
65 0.44
66 0.41
67 0.47
68 0.56
69 0.62
70 0.7
71 0.74
72 0.78
73 0.84
74 0.87
75 0.88
76 0.87
77 0.88
78 0.84
79 0.85
80 0.81
81 0.81
82 0.76
83 0.71
84 0.66
85 0.65
86 0.65
87 0.61
88 0.55
89 0.51
90 0.52
91 0.52
92 0.49
93 0.43
94 0.39
95 0.4
96 0.39
97 0.36
98 0.36
99 0.35
100 0.34
101 0.34
102 0.31
103 0.24
104 0.26
105 0.29
106 0.25
107 0.24
108 0.24
109 0.23
110 0.26
111 0.27
112 0.26
113 0.22
114 0.23
115 0.24
116 0.23
117 0.24
118 0.24
119 0.23
120 0.22
121 0.21
122 0.19
123 0.18
124 0.22
125 0.24
126 0.22
127 0.22
128 0.25