Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DZV1

Protein Details
Accession A5DZV1    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
148-174ILFCLKHKPPSRYYQKNKNNNNKTKIRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, E.R. 4, nucl 3.5, extr 3, cyto_nucl 3, pero 2, cyto 1.5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG lel:LELG_02888  -  
Amino Acid Sequences MNVCMFVTTYIYLQPNIVSNSVLLAAKGNYKSFHPHFVFFFFIAACSLSFNIFIIHHIDLHLRPGFNHHYQKCIPYFPPPSTPTFAIYFFQEIGNHPFPPSSSSSSSLFLSSPRLCEKFIPIAIHNLVHAFDHFNQSLNTYLIPFCFILFCLKHKPPSRYYQKNKNNNNKTKIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.19
5 0.15
6 0.13
7 0.14
8 0.15
9 0.14
10 0.1
11 0.1
12 0.1
13 0.15
14 0.17
15 0.18
16 0.17
17 0.19
18 0.27
19 0.28
20 0.37
21 0.34
22 0.35
23 0.35
24 0.36
25 0.37
26 0.29
27 0.27
28 0.18
29 0.15
30 0.13
31 0.12
32 0.09
33 0.07
34 0.08
35 0.07
36 0.07
37 0.07
38 0.08
39 0.07
40 0.08
41 0.1
42 0.1
43 0.1
44 0.1
45 0.12
46 0.11
47 0.15
48 0.16
49 0.13
50 0.13
51 0.17
52 0.22
53 0.27
54 0.35
55 0.32
56 0.35
57 0.36
58 0.41
59 0.38
60 0.36
61 0.3
62 0.29
63 0.32
64 0.29
65 0.34
66 0.32
67 0.33
68 0.33
69 0.33
70 0.28
71 0.25
72 0.24
73 0.18
74 0.17
75 0.14
76 0.12
77 0.12
78 0.1
79 0.1
80 0.15
81 0.16
82 0.16
83 0.15
84 0.15
85 0.14
86 0.17
87 0.18
88 0.16
89 0.17
90 0.19
91 0.21
92 0.23
93 0.23
94 0.21
95 0.18
96 0.14
97 0.18
98 0.16
99 0.17
100 0.19
101 0.2
102 0.2
103 0.21
104 0.25
105 0.25
106 0.27
107 0.27
108 0.24
109 0.27
110 0.27
111 0.27
112 0.23
113 0.18
114 0.15
115 0.12
116 0.12
117 0.11
118 0.11
119 0.16
120 0.16
121 0.17
122 0.17
123 0.18
124 0.2
125 0.17
126 0.16
127 0.12
128 0.12
129 0.11
130 0.13
131 0.12
132 0.1
133 0.1
134 0.1
135 0.15
136 0.16
137 0.2
138 0.27
139 0.31
140 0.4
141 0.47
142 0.53
143 0.54
144 0.63
145 0.7
146 0.73
147 0.78
148 0.8
149 0.83
150 0.87
151 0.91
152 0.92
153 0.92
154 0.91