Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DVF8

Protein Details
Accession A5DVF8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTNKGKKKVNPFDRKQFYDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 11.333, cyto_nucl 9.333, mito 7.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027500  Ribosomal_S1/3_euk  
IPR001593  Ribosomal_S3Ae  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lel:LELG_01344  -  
Pfam View protein in Pfam  
PF01015  Ribosomal_S3Ae  
Amino Acid Sequences MTNKGKKKVNPFDRKQFYDIQAPSTFTNTYVGKTLVNKSAGTFSSTDALKGRVFEVNLGDLTLEDNAYRKVKLRADEVQGNKILTNFHGMDFTSDKLRSLVRKWQSLVEANVTVKTADDYVLRVFAIAFTKRQANQVKKTTYAQSSKLREVRKKMVEILTREVSNSTLSQLTSKLIPEVISREIEKSTQTIFPLQNVHIRKVKLLKQPKFDLGSLLALHGEASEEKGKKVAGGFKDVVLESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.78
3 0.75
4 0.67
5 0.66
6 0.58
7 0.52
8 0.45
9 0.42
10 0.39
11 0.34
12 0.3
13 0.22
14 0.25
15 0.2
16 0.19
17 0.19
18 0.19
19 0.19
20 0.23
21 0.26
22 0.27
23 0.28
24 0.27
25 0.26
26 0.3
27 0.28
28 0.26
29 0.23
30 0.18
31 0.2
32 0.2
33 0.2
34 0.17
35 0.18
36 0.17
37 0.17
38 0.17
39 0.16
40 0.16
41 0.16
42 0.17
43 0.16
44 0.15
45 0.14
46 0.12
47 0.09
48 0.1
49 0.08
50 0.07
51 0.05
52 0.06
53 0.09
54 0.11
55 0.11
56 0.14
57 0.2
58 0.23
59 0.27
60 0.31
61 0.34
62 0.39
63 0.46
64 0.45
65 0.44
66 0.41
67 0.38
68 0.33
69 0.28
70 0.22
71 0.15
72 0.17
73 0.13
74 0.12
75 0.13
76 0.12
77 0.14
78 0.15
79 0.15
80 0.14
81 0.13
82 0.13
83 0.14
84 0.16
85 0.16
86 0.18
87 0.26
88 0.27
89 0.31
90 0.32
91 0.33
92 0.34
93 0.34
94 0.32
95 0.26
96 0.23
97 0.19
98 0.19
99 0.16
100 0.13
101 0.1
102 0.09
103 0.07
104 0.06
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.06
111 0.06
112 0.06
113 0.09
114 0.08
115 0.09
116 0.1
117 0.13
118 0.14
119 0.21
120 0.28
121 0.32
122 0.39
123 0.46
124 0.47
125 0.47
126 0.49
127 0.46
128 0.44
129 0.41
130 0.39
131 0.4
132 0.42
133 0.46
134 0.49
135 0.52
136 0.51
137 0.54
138 0.57
139 0.54
140 0.52
141 0.5
142 0.52
143 0.51
144 0.48
145 0.47
146 0.41
147 0.36
148 0.34
149 0.3
150 0.23
151 0.19
152 0.16
153 0.12
154 0.1
155 0.1
156 0.11
157 0.11
158 0.12
159 0.11
160 0.11
161 0.1
162 0.1
163 0.11
164 0.11
165 0.13
166 0.15
167 0.16
168 0.16
169 0.17
170 0.17
171 0.17
172 0.17
173 0.16
174 0.16
175 0.16
176 0.17
177 0.21
178 0.21
179 0.23
180 0.25
181 0.25
182 0.3
183 0.3
184 0.34
185 0.34
186 0.34
187 0.36
188 0.4
189 0.47
190 0.5
191 0.58
192 0.61
193 0.64
194 0.69
195 0.71
196 0.67
197 0.59
198 0.53
199 0.44
200 0.4
201 0.32
202 0.26
203 0.19
204 0.15
205 0.14
206 0.11
207 0.1
208 0.06
209 0.1
210 0.17
211 0.18
212 0.18
213 0.2
214 0.21
215 0.21
216 0.26
217 0.29
218 0.26
219 0.33
220 0.33
221 0.33
222 0.36