Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JZ17

Protein Details
Accession A0A4Z1JZ17    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
122-151PEPIGPERPKKKSKKELKKIQKAKEAKEKGBasic
NLS Segment(s)
PositionSequence
127-160PERPKKKSKKELKKIQKAKEAKEKGWFKQNVKPD
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 11.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MSAPEVTQDDLLAFHAAHLGDTSTEHFVQQFLGPVEDYYEEEVDDDGLGYYPDGVKRTLTDEQIAIFRHSEIQAILRKRRHAAESNETSNEQPQSETSRTVRTEKVEAEEEDGEIPESFSHPEPIGPERPKKKSKKELKKIQKAKEAKEKGWFKQNVKPDLRKRTWDKVETSIGSLAYDDDESGGNSQASSSAPQRRKITYDDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.1
4 0.1
5 0.1
6 0.09
7 0.08
8 0.09
9 0.12
10 0.13
11 0.13
12 0.14
13 0.13
14 0.13
15 0.14
16 0.14
17 0.16
18 0.13
19 0.14
20 0.13
21 0.13
22 0.15
23 0.14
24 0.14
25 0.12
26 0.12
27 0.1
28 0.1
29 0.11
30 0.09
31 0.08
32 0.07
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.06
39 0.08
40 0.09
41 0.09
42 0.1
43 0.11
44 0.16
45 0.19
46 0.19
47 0.19
48 0.18
49 0.19
50 0.21
51 0.22
52 0.17
53 0.14
54 0.13
55 0.14
56 0.13
57 0.13
58 0.1
59 0.13
60 0.18
61 0.23
62 0.29
63 0.31
64 0.33
65 0.35
66 0.38
67 0.39
68 0.4
69 0.42
70 0.45
71 0.47
72 0.48
73 0.47
74 0.44
75 0.39
76 0.34
77 0.28
78 0.19
79 0.13
80 0.11
81 0.15
82 0.16
83 0.18
84 0.17
85 0.21
86 0.22
87 0.25
88 0.26
89 0.22
90 0.24
91 0.22
92 0.24
93 0.21
94 0.2
95 0.2
96 0.18
97 0.16
98 0.14
99 0.13
100 0.11
101 0.08
102 0.08
103 0.05
104 0.05
105 0.06
106 0.07
107 0.08
108 0.08
109 0.08
110 0.1
111 0.14
112 0.22
113 0.25
114 0.32
115 0.38
116 0.47
117 0.56
118 0.63
119 0.69
120 0.72
121 0.79
122 0.83
123 0.86
124 0.89
125 0.91
126 0.93
127 0.92
128 0.9
129 0.89
130 0.84
131 0.8
132 0.8
133 0.75
134 0.67
135 0.67
136 0.65
137 0.59
138 0.63
139 0.62
140 0.55
141 0.56
142 0.61
143 0.61
144 0.63
145 0.68
146 0.68
147 0.72
148 0.73
149 0.75
150 0.74
151 0.75
152 0.76
153 0.72
154 0.67
155 0.63
156 0.65
157 0.57
158 0.52
159 0.43
160 0.34
161 0.28
162 0.24
163 0.18
164 0.12
165 0.11
166 0.08
167 0.07
168 0.07
169 0.08
170 0.09
171 0.1
172 0.09
173 0.09
174 0.09
175 0.09
176 0.1
177 0.13
178 0.19
179 0.27
180 0.33
181 0.41
182 0.46
183 0.49
184 0.52