Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JTP4

Protein Details
Accession A0A4Z1JTP4   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-35FVDRRAPRRKSTQIVRERRSHSHydrophilic
NLS Segment(s)
PositionSequence
211-215RKSRK
Subcellular Location(s) nucl 18, cyto_nucl 13, cyto 6
Family & Domain DBs
Amino Acid Sequences MCLFGIPKDEDIVFVDRRAPRRKSTQIVRERRSHSSRPVSRVSETVIRQHSHRPSTPMSEVHRHSTSMTEIHRGPPSHRHSSSMTEIHRSHTPVPPTPKPATPVPPPASVAPPPPPPPPPASVGFPPGYAPGYPPPPMSVAPPPSHHHHIPPPSPSIMPQSPAPSYRDLSPPRVPTPPEESRVELIKVEEEHWPPHSHGRSSPSAIHVSRRKSRKGSVSSGRDRDRSEREEIYIQRDRIIERGTPSRHASSSPSSFARRGSRGSGTPEPVQSGYRTVEGTGWDDRRPITPSGYRVVDGAGARRGSGVGIVNIHREREWEREKVSPSEFGGRRGSIPYDNGSIGRPRSSAGRFAERERVVMDEGGRRREMYRRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.27
3 0.3
4 0.38
5 0.46
6 0.48
7 0.5
8 0.59
9 0.67
10 0.7
11 0.75
12 0.78
13 0.79
14 0.85
15 0.84
16 0.84
17 0.8
18 0.79
19 0.77
20 0.73
21 0.72
22 0.73
23 0.73
24 0.71
25 0.73
26 0.68
27 0.62
28 0.57
29 0.52
30 0.49
31 0.43
32 0.45
33 0.43
34 0.4
35 0.4
36 0.47
37 0.5
38 0.5
39 0.51
40 0.49
41 0.48
42 0.53
43 0.55
44 0.52
45 0.5
46 0.51
47 0.5
48 0.51
49 0.48
50 0.42
51 0.38
52 0.35
53 0.31
54 0.28
55 0.27
56 0.25
57 0.25
58 0.29
59 0.33
60 0.32
61 0.33
62 0.37
63 0.43
64 0.47
65 0.47
66 0.46
67 0.44
68 0.48
69 0.52
70 0.49
71 0.43
72 0.41
73 0.41
74 0.4
75 0.41
76 0.39
77 0.36
78 0.34
79 0.37
80 0.37
81 0.45
82 0.46
83 0.5
84 0.5
85 0.49
86 0.47
87 0.47
88 0.46
89 0.44
90 0.49
91 0.46
92 0.44
93 0.44
94 0.41
95 0.4
96 0.35
97 0.33
98 0.28
99 0.29
100 0.3
101 0.31
102 0.32
103 0.31
104 0.33
105 0.32
106 0.32
107 0.3
108 0.3
109 0.28
110 0.3
111 0.28
112 0.24
113 0.22
114 0.19
115 0.17
116 0.14
117 0.14
118 0.13
119 0.15
120 0.16
121 0.16
122 0.16
123 0.17
124 0.17
125 0.19
126 0.21
127 0.22
128 0.23
129 0.27
130 0.29
131 0.32
132 0.37
133 0.35
134 0.34
135 0.36
136 0.4
137 0.41
138 0.4
139 0.38
140 0.34
141 0.33
142 0.3
143 0.3
144 0.24
145 0.22
146 0.21
147 0.21
148 0.21
149 0.22
150 0.23
151 0.19
152 0.2
153 0.2
154 0.26
155 0.26
156 0.31
157 0.34
158 0.35
159 0.36
160 0.37
161 0.36
162 0.32
163 0.37
164 0.35
165 0.34
166 0.32
167 0.31
168 0.3
169 0.3
170 0.27
171 0.2
172 0.16
173 0.13
174 0.12
175 0.12
176 0.14
177 0.14
178 0.14
179 0.16
180 0.17
181 0.17
182 0.23
183 0.24
184 0.21
185 0.23
186 0.27
187 0.27
188 0.28
189 0.29
190 0.25
191 0.27
192 0.27
193 0.31
194 0.31
195 0.35
196 0.4
197 0.44
198 0.47
199 0.47
200 0.52
201 0.55
202 0.56
203 0.58
204 0.6
205 0.63
206 0.65
207 0.68
208 0.65
209 0.59
210 0.55
211 0.52
212 0.49
213 0.44
214 0.41
215 0.36
216 0.34
217 0.38
218 0.37
219 0.39
220 0.38
221 0.34
222 0.32
223 0.32
224 0.3
225 0.27
226 0.28
227 0.22
228 0.2
229 0.27
230 0.26
231 0.29
232 0.32
233 0.32
234 0.3
235 0.3
236 0.3
237 0.29
238 0.3
239 0.3
240 0.3
241 0.3
242 0.3
243 0.34
244 0.36
245 0.32
246 0.32
247 0.32
248 0.33
249 0.33
250 0.39
251 0.39
252 0.37
253 0.37
254 0.36
255 0.34
256 0.31
257 0.29
258 0.23
259 0.21
260 0.18
261 0.17
262 0.16
263 0.14
264 0.15
265 0.15
266 0.17
267 0.2
268 0.21
269 0.2
270 0.21
271 0.22
272 0.23
273 0.25
274 0.24
275 0.24
276 0.26
277 0.29
278 0.33
279 0.33
280 0.31
281 0.27
282 0.26
283 0.24
284 0.2
285 0.2
286 0.19
287 0.18
288 0.17
289 0.17
290 0.17
291 0.13
292 0.14
293 0.13
294 0.1
295 0.13
296 0.14
297 0.21
298 0.22
299 0.23
300 0.21
301 0.22
302 0.24
303 0.31
304 0.35
305 0.34
306 0.36
307 0.42
308 0.46
309 0.48
310 0.47
311 0.42
312 0.39
313 0.44
314 0.42
315 0.4
316 0.41
317 0.36
318 0.35
319 0.35
320 0.35
321 0.28
322 0.3
323 0.29
324 0.27
325 0.27
326 0.27
327 0.26
328 0.29
329 0.28
330 0.27
331 0.24
332 0.22
333 0.28
334 0.3
335 0.35
336 0.35
337 0.43
338 0.43
339 0.48
340 0.56
341 0.5
342 0.49
343 0.42
344 0.39
345 0.31
346 0.31
347 0.29
348 0.28
349 0.32
350 0.36
351 0.36
352 0.35
353 0.35