Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DSS5

Protein Details
Accession A5DSS5    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MPKSTKKPKKNSLPPADFSKIHydrophilic
125-147RVPKVELLKRKNRKQLREQKGGNBasic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001748  BUD31  
Gene Ontology GO:0005634  C:nucleus  
KEGG lel:LELG_00411  -  
Pfam View protein in Pfam  
PF01125  G10  
Amino Acid Sequences MPKSTKKPKKNSLPPADFSKIAPTINQYKQKLRHAQLQPLDSKTTLSRISLTWPITRLLHNCTRFVQQQNDEGELSPELFEWLKVQDYVDEKLLNKWGKRGYEKLCCLGCINRLGQGNGAVCVCRVPKVELLKRKNRKQLREQKGGNANGEQNDQNDQNDQGEEEDLEEESTDVDKVDVECVTCGCRGCASTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.82
3 0.75
4 0.65
5 0.55
6 0.5
7 0.41
8 0.34
9 0.31
10 0.27
11 0.32
12 0.39
13 0.47
14 0.45
15 0.51
16 0.58
17 0.66
18 0.7
19 0.66
20 0.68
21 0.65
22 0.7
23 0.67
24 0.66
25 0.61
26 0.53
27 0.51
28 0.41
29 0.37
30 0.29
31 0.27
32 0.22
33 0.19
34 0.18
35 0.16
36 0.2
37 0.24
38 0.25
39 0.23
40 0.23
41 0.24
42 0.24
43 0.26
44 0.24
45 0.25
46 0.31
47 0.31
48 0.31
49 0.31
50 0.34
51 0.36
52 0.39
53 0.39
54 0.34
55 0.38
56 0.38
57 0.38
58 0.33
59 0.29
60 0.25
61 0.19
62 0.16
63 0.1
64 0.08
65 0.07
66 0.06
67 0.06
68 0.06
69 0.07
70 0.07
71 0.07
72 0.07
73 0.09
74 0.11
75 0.12
76 0.13
77 0.13
78 0.13
79 0.14
80 0.2
81 0.2
82 0.18
83 0.21
84 0.23
85 0.26
86 0.29
87 0.34
88 0.34
89 0.4
90 0.41
91 0.43
92 0.4
93 0.36
94 0.34
95 0.3
96 0.26
97 0.21
98 0.19
99 0.18
100 0.19
101 0.18
102 0.18
103 0.19
104 0.16
105 0.14
106 0.14
107 0.1
108 0.09
109 0.1
110 0.1
111 0.09
112 0.11
113 0.12
114 0.17
115 0.26
116 0.34
117 0.42
118 0.5
119 0.59
120 0.67
121 0.73
122 0.78
123 0.78
124 0.79
125 0.81
126 0.84
127 0.83
128 0.83
129 0.77
130 0.76
131 0.76
132 0.7
133 0.61
134 0.53
135 0.46
136 0.38
137 0.38
138 0.3
139 0.23
140 0.23
141 0.22
142 0.2
143 0.19
144 0.19
145 0.17
146 0.16
147 0.16
148 0.13
149 0.12
150 0.11
151 0.1
152 0.1
153 0.09
154 0.09
155 0.08
156 0.07
157 0.07
158 0.08
159 0.07
160 0.06
161 0.06
162 0.07
163 0.08
164 0.1
165 0.1
166 0.1
167 0.11
168 0.12
169 0.14
170 0.15
171 0.15
172 0.14
173 0.16