Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1K5N8

Protein Details
Accession A0A4Z1K5N8    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-26KDSTIHHCPKKSKGNCRRAYTPGHydrophilic
85-111GSNNNGKEKDKKLKPKTVNKKLKSGYSHydrophilic
NLS Segment(s)
PositionSequence
90-108GKEKDKKLKPKTVNKKLKS
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
Amino Acid Sequences MVTKDSTIHHCPKKSKGNCRRAYTPGPNSRPYCSAHMTYCKEEGCRLPYLLGKQRCERCAATAEKEELLAKETAEKEAKDKENAGSNNNGKEKDKKLKPKTVNKKLKSGYSGPFKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.76
3 0.78
4 0.81
5 0.83
6 0.85
7 0.82
8 0.78
9 0.78
10 0.77
11 0.76
12 0.75
13 0.71
14 0.71
15 0.67
16 0.63
17 0.57
18 0.5
19 0.44
20 0.38
21 0.36
22 0.32
23 0.38
24 0.39
25 0.39
26 0.38
27 0.34
28 0.31
29 0.3
30 0.29
31 0.24
32 0.22
33 0.2
34 0.19
35 0.2
36 0.24
37 0.31
38 0.32
39 0.32
40 0.37
41 0.41
42 0.4
43 0.42
44 0.37
45 0.31
46 0.32
47 0.31
48 0.28
49 0.26
50 0.26
51 0.22
52 0.22
53 0.21
54 0.15
55 0.15
56 0.11
57 0.09
58 0.12
59 0.12
60 0.15
61 0.16
62 0.17
63 0.17
64 0.24
65 0.27
66 0.25
67 0.26
68 0.25
69 0.32
70 0.33
71 0.33
72 0.34
73 0.34
74 0.39
75 0.41
76 0.41
77 0.36
78 0.42
79 0.47
80 0.5
81 0.56
82 0.6
83 0.66
84 0.74
85 0.81
86 0.86
87 0.89
88 0.9
89 0.91
90 0.85
91 0.86
92 0.81
93 0.79
94 0.74
95 0.69
96 0.66