Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JU48

Protein Details
Accession A0A4Z1JU48   
Localization Confidence Medium
Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
128-155GTPWMPKLGRCRRKKLRARSLAKAKEQMHydrophilic
NLS Segment(s)
PositionSequence
137-151RCRRKKLRARSLAKA
Subcellular Location(s) nucl 20, cyto_nucl 13, cyto 4
Family & Domain DBs
Amino Acid Sequences MEDHSPPLPIRAKDTQSVVQNALSKQDIDFRAAADVHSDQKIFDGAGSPEPLSHNVRIEPAAVYNDVASQSQLPLRNDNKEQQNSNRGARINPDKLGMSAAGSIDSQRSPKKKPNGRVLICEILGPDGTPWMPKLGRCRRKKLRARSLAKAKEQMALEEQRAAEKERKYSEMKDAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.47
3 0.46
4 0.48
5 0.43
6 0.39
7 0.39
8 0.35
9 0.34
10 0.29
11 0.24
12 0.21
13 0.26
14 0.24
15 0.22
16 0.22
17 0.19
18 0.21
19 0.2
20 0.2
21 0.15
22 0.16
23 0.16
24 0.17
25 0.16
26 0.13
27 0.14
28 0.15
29 0.11
30 0.1
31 0.1
32 0.09
33 0.12
34 0.13
35 0.12
36 0.13
37 0.14
38 0.17
39 0.18
40 0.18
41 0.18
42 0.17
43 0.18
44 0.18
45 0.17
46 0.14
47 0.12
48 0.12
49 0.11
50 0.1
51 0.09
52 0.09
53 0.09
54 0.08
55 0.08
56 0.06
57 0.07
58 0.1
59 0.14
60 0.15
61 0.21
62 0.23
63 0.27
64 0.29
65 0.34
66 0.39
67 0.39
68 0.41
69 0.39
70 0.44
71 0.43
72 0.43
73 0.4
74 0.33
75 0.29
76 0.31
77 0.34
78 0.29
79 0.26
80 0.26
81 0.23
82 0.22
83 0.22
84 0.17
85 0.1
86 0.08
87 0.07
88 0.06
89 0.06
90 0.06
91 0.06
92 0.07
93 0.09
94 0.14
95 0.18
96 0.23
97 0.31
98 0.41
99 0.49
100 0.57
101 0.65
102 0.71
103 0.7
104 0.71
105 0.68
106 0.61
107 0.53
108 0.44
109 0.33
110 0.24
111 0.2
112 0.15
113 0.09
114 0.07
115 0.07
116 0.07
117 0.07
118 0.1
119 0.12
120 0.14
121 0.25
122 0.35
123 0.45
124 0.53
125 0.63
126 0.7
127 0.8
128 0.87
129 0.88
130 0.88
131 0.89
132 0.89
133 0.88
134 0.88
135 0.86
136 0.82
137 0.77
138 0.67
139 0.62
140 0.55
141 0.47
142 0.42
143 0.38
144 0.32
145 0.3
146 0.29
147 0.26
148 0.27
149 0.29
150 0.3
151 0.3
152 0.36
153 0.37
154 0.42
155 0.44
156 0.46