Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Z1JXS5

Protein Details
Accession A0A4Z1JXS5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
219-241VTYTPRMSPAPKGKRRKVDHHVEHydrophilic
NLS Segment(s)
PositionSequence
230-235KGKRRK
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 12.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
Amino Acid Sequences MESPIKTSAPAAVSAPILPPPKRSMSTTKPKLPQLKTPMSSTFPSELSALSNSARSPLPGYADFIIKQEDSIKTPITPPLAYTDFLKTMNSPIVTEIKCSRPTPTSAPSSESLTSSEGSDCSCNCDAHKSPATSVPPTPFSYPTSAPSSAILGRLRIPASPASSYAESPLSARSPFSARSARSPYDWDLRAKGRYFDIKPQKQTRSSVRQVREVVTRTVTYTPRMSPAPKGKRRKVDHHVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.23
5 0.23
6 0.25
7 0.28
8 0.34
9 0.36
10 0.4
11 0.43
12 0.48
13 0.58
14 0.64
15 0.68
16 0.68
17 0.74
18 0.79
19 0.74
20 0.73
21 0.72
22 0.72
23 0.66
24 0.64
25 0.59
26 0.54
27 0.51
28 0.45
29 0.38
30 0.29
31 0.27
32 0.23
33 0.19
34 0.17
35 0.17
36 0.14
37 0.12
38 0.13
39 0.11
40 0.13
41 0.13
42 0.12
43 0.13
44 0.13
45 0.17
46 0.16
47 0.19
48 0.18
49 0.2
50 0.2
51 0.18
52 0.19
53 0.15
54 0.14
55 0.15
56 0.16
57 0.16
58 0.18
59 0.18
60 0.17
61 0.18
62 0.21
63 0.2
64 0.18
65 0.16
66 0.19
67 0.2
68 0.2
69 0.2
70 0.2
71 0.18
72 0.19
73 0.19
74 0.14
75 0.14
76 0.16
77 0.15
78 0.12
79 0.13
80 0.18
81 0.18
82 0.2
83 0.21
84 0.22
85 0.25
86 0.26
87 0.27
88 0.23
89 0.26
90 0.28
91 0.3
92 0.3
93 0.28
94 0.3
95 0.29
96 0.3
97 0.27
98 0.23
99 0.19
100 0.16
101 0.15
102 0.12
103 0.12
104 0.08
105 0.08
106 0.09
107 0.07
108 0.11
109 0.12
110 0.12
111 0.12
112 0.17
113 0.18
114 0.23
115 0.28
116 0.24
117 0.24
118 0.29
119 0.31
120 0.28
121 0.28
122 0.25
123 0.23
124 0.24
125 0.25
126 0.22
127 0.21
128 0.23
129 0.22
130 0.23
131 0.25
132 0.23
133 0.22
134 0.2
135 0.2
136 0.17
137 0.2
138 0.17
139 0.13
140 0.14
141 0.16
142 0.16
143 0.14
144 0.15
145 0.14
146 0.16
147 0.16
148 0.16
149 0.17
150 0.18
151 0.18
152 0.18
153 0.16
154 0.14
155 0.13
156 0.14
157 0.12
158 0.12
159 0.12
160 0.12
161 0.14
162 0.16
163 0.2
164 0.24
165 0.24
166 0.31
167 0.37
168 0.37
169 0.36
170 0.39
171 0.38
172 0.4
173 0.41
174 0.36
175 0.35
176 0.38
177 0.42
178 0.39
179 0.37
180 0.34
181 0.4
182 0.4
183 0.45
184 0.52
185 0.55
186 0.63
187 0.69
188 0.72
189 0.69
190 0.73
191 0.73
192 0.72
193 0.73
194 0.73
195 0.68
196 0.69
197 0.66
198 0.63
199 0.61
200 0.54
201 0.48
202 0.43
203 0.39
204 0.33
205 0.36
206 0.34
207 0.31
208 0.31
209 0.3
210 0.3
211 0.34
212 0.34
213 0.38
214 0.47
215 0.54
216 0.6
217 0.69
218 0.74
219 0.8
220 0.86
221 0.87