Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q752L7

Protein Details
Accession Q752L7    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
235-287GNKTKFHLKKSEQKKVVQKWKFDHMKARQRDKVMERKRKKLRGKEFRSFEFHRBasic
NLS Segment(s)
PositionSequence
105-124RRASGARRHKHAPSEQSAKR
242-288LKKSEQKKVVQKWKFDHMKARQRDKVMERKRKKLRGKEFRSFEFHRK
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0030686  C:90S preribosome  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0000469  P:cleavage involved in rRNA processing  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
KEGG ago:AGOS_AFR557C  -  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MSYYFKNLQPGVDESSSEDELEQMLHGKQRADDASSEDDELSSLTFGSLKKAEDALQREEAHEAVHNRARAEARPRGSARSRQEASDSEDSSDSEAGFFEEDDRRRASGARRHKHAPSEQSAKRPVSKVRQIPGLESARREEPQPDIRFDKSLGRAEDLAKVRSNYRFLDDYRQQEISELSALLADKKFLRKASEREVQQLQQRLTSMRSRLQTVQNRDTERQVLRDYERSINQGNKTKFHLKKSEQKKVVQKWKFDHMKARQRDKVMERKRKKLRGKEFRSFEFHRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.3
3 0.29
4 0.25
5 0.21
6 0.15
7 0.14
8 0.14
9 0.12
10 0.09
11 0.1
12 0.14
13 0.16
14 0.17
15 0.17
16 0.23
17 0.24
18 0.24
19 0.24
20 0.24
21 0.28
22 0.28
23 0.28
24 0.22
25 0.2
26 0.18
27 0.16
28 0.12
29 0.07
30 0.06
31 0.05
32 0.07
33 0.08
34 0.12
35 0.14
36 0.14
37 0.16
38 0.17
39 0.21
40 0.25
41 0.3
42 0.31
43 0.35
44 0.35
45 0.34
46 0.33
47 0.3
48 0.24
49 0.23
50 0.2
51 0.19
52 0.23
53 0.24
54 0.23
55 0.26
56 0.27
57 0.28
58 0.34
59 0.36
60 0.35
61 0.41
62 0.42
63 0.46
64 0.49
65 0.53
66 0.52
67 0.54
68 0.52
69 0.45
70 0.47
71 0.43
72 0.44
73 0.41
74 0.36
75 0.28
76 0.27
77 0.26
78 0.24
79 0.22
80 0.15
81 0.09
82 0.08
83 0.07
84 0.06
85 0.06
86 0.07
87 0.12
88 0.13
89 0.16
90 0.17
91 0.17
92 0.18
93 0.2
94 0.25
95 0.29
96 0.39
97 0.43
98 0.47
99 0.51
100 0.54
101 0.58
102 0.57
103 0.55
104 0.51
105 0.53
106 0.51
107 0.53
108 0.55
109 0.5
110 0.47
111 0.44
112 0.42
113 0.42
114 0.46
115 0.46
116 0.44
117 0.48
118 0.46
119 0.44
120 0.45
121 0.41
122 0.34
123 0.3
124 0.29
125 0.24
126 0.24
127 0.24
128 0.18
129 0.18
130 0.26
131 0.27
132 0.28
133 0.28
134 0.29
135 0.29
136 0.29
137 0.29
138 0.24
139 0.27
140 0.25
141 0.23
142 0.23
143 0.23
144 0.29
145 0.26
146 0.23
147 0.2
148 0.2
149 0.21
150 0.23
151 0.25
152 0.19
153 0.21
154 0.22
155 0.22
156 0.3
157 0.32
158 0.34
159 0.35
160 0.35
161 0.31
162 0.29
163 0.28
164 0.2
165 0.16
166 0.11
167 0.07
168 0.08
169 0.08
170 0.09
171 0.08
172 0.09
173 0.1
174 0.13
175 0.16
176 0.17
177 0.22
178 0.27
179 0.32
180 0.39
181 0.45
182 0.44
183 0.46
184 0.49
185 0.47
186 0.46
187 0.47
188 0.39
189 0.33
190 0.33
191 0.29
192 0.28
193 0.29
194 0.28
195 0.27
196 0.29
197 0.31
198 0.35
199 0.43
200 0.48
201 0.51
202 0.55
203 0.56
204 0.59
205 0.57
206 0.56
207 0.52
208 0.46
209 0.41
210 0.36
211 0.35
212 0.34
213 0.37
214 0.38
215 0.37
216 0.38
217 0.38
218 0.4
219 0.41
220 0.44
221 0.47
222 0.47
223 0.44
224 0.49
225 0.55
226 0.56
227 0.58
228 0.62
229 0.6
230 0.68
231 0.75
232 0.79
233 0.75
234 0.78
235 0.8
236 0.81
237 0.84
238 0.8
239 0.78
240 0.72
241 0.76
242 0.77
243 0.71
244 0.71
245 0.71
246 0.74
247 0.76
248 0.81
249 0.77
250 0.73
251 0.78
252 0.76
253 0.77
254 0.78
255 0.79
256 0.78
257 0.82
258 0.87
259 0.89
260 0.9
261 0.9
262 0.91
263 0.91
264 0.91
265 0.91
266 0.88
267 0.84
268 0.82