Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DXH4

Protein Details
Accession A5DXH4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MKMKLNKKKTKIQETRKKIRKETSNTNFHydrophilic
NLS Segment(s)
PositionSequence
6-21NKKKTKIQETRKKIRK
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR024766  Znf_RING_H2  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
KEGG lel:LELG_02061  -  
Pfam View protein in Pfam  
PF12678  zf-rbx1  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16485  mRING-H2-C3H2C2D_RBX1  
Amino Acid Sequences MKMKLNKKKTKIQETRKKIRKETSNTNFVTDIQIENCAICRNHLMEPCIECQPNSMANGGEECIAAWGMCNHAFHLHCIKRWLKTRNACPLDNTEWVYQKFGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.92
3 0.91
4 0.89
5 0.85
6 0.84
7 0.83
8 0.8
9 0.81
10 0.78
11 0.78
12 0.7
13 0.65
14 0.56
15 0.47
16 0.41
17 0.3
18 0.23
19 0.14
20 0.15
21 0.12
22 0.11
23 0.11
24 0.11
25 0.1
26 0.1
27 0.11
28 0.12
29 0.16
30 0.18
31 0.19
32 0.18
33 0.2
34 0.21
35 0.22
36 0.2
37 0.16
38 0.15
39 0.15
40 0.15
41 0.13
42 0.12
43 0.09
44 0.09
45 0.1
46 0.09
47 0.08
48 0.06
49 0.05
50 0.05
51 0.05
52 0.04
53 0.04
54 0.04
55 0.06
56 0.08
57 0.08
58 0.08
59 0.13
60 0.13
61 0.16
62 0.26
63 0.27
64 0.27
65 0.34
66 0.37
67 0.4
68 0.49
69 0.52
70 0.52
71 0.59
72 0.66
73 0.71
74 0.73
75 0.67
76 0.62
77 0.62
78 0.57
79 0.52
80 0.47
81 0.41
82 0.41
83 0.41