Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DW04

Protein Details
Accession A5DW04    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
296-315KLSAKYPKNDEQNTKRQMRFHydrophilic
NLS Segment(s)
PositionSequence
316-332GKGEPIAKRTRHEESKV
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003738  SRAP  
IPR036590  SRAP-like  
Gene Ontology GO:0008233  F:peptidase activity  
GO:0003697  F:single-stranded DNA binding  
GO:0006974  P:DNA damage response  
GO:0018142  P:protein-DNA covalent cross-linking  
GO:0006508  P:proteolysis  
KEGG lel:LELG_01540  -  
Pfam View protein in Pfam  
PF02586  SRAP  
Amino Acid Sequences MSSVIDFAPSYNIAPTNTAIIIYMAELPEGYNAKYVFEPSKFGLVPVWAKPEDPTPVNQGKENQGKPYSRELGRHEGRYFNCRRESLEQNKPVWSSAKKYRCVIPIQGYFEWQKGKEKDEKTPYFVHSTSAPFIYLAGFYSHNYNYKEDFNVNDEFLSSFTIVTGPADKTDEYSDISWLHPRKPIFIKPGTKAWYDWLKPSGSWSNMLLAESLNSAKNIAYKNIDCYRVSNKVGNPTNKGKEILKKVGDRNISPISNFFTPSSTNKEKHFKKEENNLGTENKQDQRKIKGEKDISKLSAKYPKNDEQNTKRQMRFGKGEPIAKRTRHEESKVKREQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.18
4 0.17
5 0.16
6 0.14
7 0.12
8 0.12
9 0.1
10 0.12
11 0.09
12 0.08
13 0.08
14 0.08
15 0.11
16 0.13
17 0.12
18 0.14
19 0.14
20 0.16
21 0.17
22 0.21
23 0.22
24 0.22
25 0.25
26 0.23
27 0.29
28 0.27
29 0.27
30 0.25
31 0.24
32 0.27
33 0.26
34 0.3
35 0.24
36 0.24
37 0.25
38 0.28
39 0.29
40 0.27
41 0.27
42 0.29
43 0.35
44 0.36
45 0.38
46 0.38
47 0.41
48 0.49
49 0.48
50 0.47
51 0.47
52 0.48
53 0.49
54 0.54
55 0.52
56 0.46
57 0.49
58 0.48
59 0.52
60 0.55
61 0.57
62 0.51
63 0.5
64 0.49
65 0.53
66 0.52
67 0.48
68 0.49
69 0.44
70 0.47
71 0.46
72 0.53
73 0.53
74 0.58
75 0.58
76 0.55
77 0.57
78 0.52
79 0.48
80 0.44
81 0.37
82 0.34
83 0.37
84 0.43
85 0.44
86 0.46
87 0.5
88 0.5
89 0.52
90 0.51
91 0.49
92 0.47
93 0.48
94 0.46
95 0.42
96 0.39
97 0.37
98 0.34
99 0.27
100 0.29
101 0.25
102 0.3
103 0.35
104 0.37
105 0.44
106 0.51
107 0.52
108 0.49
109 0.51
110 0.49
111 0.45
112 0.42
113 0.35
114 0.27
115 0.26
116 0.23
117 0.2
118 0.17
119 0.12
120 0.12
121 0.11
122 0.09
123 0.07
124 0.07
125 0.07
126 0.08
127 0.11
128 0.12
129 0.16
130 0.18
131 0.19
132 0.19
133 0.2
134 0.22
135 0.19
136 0.19
137 0.18
138 0.18
139 0.16
140 0.14
141 0.13
142 0.11
143 0.11
144 0.1
145 0.07
146 0.05
147 0.05
148 0.06
149 0.05
150 0.05
151 0.07
152 0.06
153 0.06
154 0.08
155 0.07
156 0.08
157 0.09
158 0.1
159 0.1
160 0.1
161 0.11
162 0.1
163 0.11
164 0.15
165 0.16
166 0.17
167 0.19
168 0.19
169 0.23
170 0.27
171 0.32
172 0.33
173 0.39
174 0.43
175 0.42
176 0.48
177 0.46
178 0.42
179 0.37
180 0.36
181 0.36
182 0.31
183 0.31
184 0.28
185 0.25
186 0.24
187 0.28
188 0.29
189 0.22
190 0.22
191 0.2
192 0.2
193 0.2
194 0.2
195 0.16
196 0.11
197 0.1
198 0.09
199 0.1
200 0.07
201 0.07
202 0.07
203 0.07
204 0.11
205 0.12
206 0.14
207 0.17
208 0.17
209 0.24
210 0.28
211 0.31
212 0.28
213 0.3
214 0.34
215 0.35
216 0.37
217 0.36
218 0.33
219 0.4
220 0.47
221 0.48
222 0.48
223 0.5
224 0.52
225 0.49
226 0.49
227 0.44
228 0.45
229 0.48
230 0.5
231 0.48
232 0.5
233 0.52
234 0.56
235 0.56
236 0.49
237 0.47
238 0.45
239 0.4
240 0.34
241 0.32
242 0.29
243 0.26
244 0.27
245 0.22
246 0.17
247 0.2
248 0.22
249 0.3
250 0.32
251 0.33
252 0.38
253 0.48
254 0.53
255 0.6
256 0.66
257 0.65
258 0.67
259 0.75
260 0.79
261 0.74
262 0.71
263 0.65
264 0.59
265 0.52
266 0.48
267 0.44
268 0.4
269 0.39
270 0.41
271 0.44
272 0.49
273 0.56
274 0.6
275 0.6
276 0.64
277 0.68
278 0.71
279 0.72
280 0.7
281 0.65
282 0.63
283 0.58
284 0.54
285 0.55
286 0.5
287 0.5
288 0.51
289 0.56
290 0.6
291 0.67
292 0.7
293 0.7
294 0.77
295 0.79
296 0.8
297 0.74
298 0.71
299 0.7
300 0.68
301 0.66
302 0.61
303 0.62
304 0.59
305 0.65
306 0.62
307 0.63
308 0.63
309 0.6
310 0.59
311 0.55
312 0.58
313 0.59
314 0.63
315 0.66
316 0.68