Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E693

Protein Details
Accession A5E693    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
248-268KQNIRKVLSRRKTNTEGNYKQHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 10.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR035179  DUF5314  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0043229  C:intracellular organelle  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
KEGG lel:LELG_05132  -  
Pfam View protein in Pfam  
PF17241  Retrotran_gag_4  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MSPSNFFSNMRVPDDVKLIGKYNFEIWHMYFVNHTNYGKKNLYHYLTCDEGDENYVDDENDIFHESADAFIKASISPEILKTLRRKGLKGKAAYKAICEIYGTFTPKDKILQVTKYTEECLDESISIPERMSTANHLSRFILKQPEEEHECLMHFLWIGQSAKPIMDKFIEMNLPLAMSSFDIITSIYPHLSEPPATTPVATKTVSDRALNNSYNYLCFNCLGLGHKKAECPSPLRTISTHTAIAILKQNIRKVLSRRKTNTEGNYKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.29
4 0.27
5 0.27
6 0.27
7 0.27
8 0.26
9 0.26
10 0.26
11 0.25
12 0.26
13 0.23
14 0.28
15 0.27
16 0.25
17 0.24
18 0.25
19 0.28
20 0.29
21 0.29
22 0.28
23 0.31
24 0.38
25 0.4
26 0.38
27 0.39
28 0.42
29 0.46
30 0.42
31 0.42
32 0.39
33 0.38
34 0.36
35 0.32
36 0.25
37 0.2
38 0.19
39 0.16
40 0.12
41 0.11
42 0.11
43 0.09
44 0.09
45 0.08
46 0.07
47 0.08
48 0.09
49 0.08
50 0.08
51 0.09
52 0.09
53 0.1
54 0.11
55 0.1
56 0.08
57 0.08
58 0.09
59 0.08
60 0.09
61 0.08
62 0.08
63 0.09
64 0.09
65 0.13
66 0.14
67 0.19
68 0.22
69 0.29
70 0.35
71 0.37
72 0.39
73 0.44
74 0.53
75 0.56
76 0.58
77 0.58
78 0.58
79 0.62
80 0.6
81 0.51
82 0.46
83 0.38
84 0.31
85 0.25
86 0.18
87 0.16
88 0.18
89 0.19
90 0.16
91 0.17
92 0.18
93 0.18
94 0.19
95 0.17
96 0.19
97 0.21
98 0.25
99 0.26
100 0.28
101 0.3
102 0.29
103 0.28
104 0.23
105 0.2
106 0.16
107 0.14
108 0.12
109 0.1
110 0.09
111 0.1
112 0.11
113 0.1
114 0.09
115 0.08
116 0.08
117 0.08
118 0.08
119 0.1
120 0.13
121 0.17
122 0.18
123 0.19
124 0.19
125 0.21
126 0.21
127 0.21
128 0.23
129 0.19
130 0.21
131 0.22
132 0.26
133 0.28
134 0.28
135 0.26
136 0.2
137 0.2
138 0.18
139 0.16
140 0.12
141 0.07
142 0.06
143 0.06
144 0.09
145 0.1
146 0.09
147 0.1
148 0.1
149 0.11
150 0.12
151 0.12
152 0.1
153 0.1
154 0.11
155 0.1
156 0.13
157 0.13
158 0.11
159 0.12
160 0.11
161 0.1
162 0.09
163 0.08
164 0.06
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.05
171 0.05
172 0.06
173 0.07
174 0.07
175 0.07
176 0.08
177 0.1
178 0.11
179 0.11
180 0.11
181 0.14
182 0.16
183 0.16
184 0.16
185 0.16
186 0.17
187 0.2
188 0.19
189 0.17
190 0.18
191 0.24
192 0.27
193 0.26
194 0.25
195 0.28
196 0.34
197 0.35
198 0.32
199 0.3
200 0.28
201 0.28
202 0.28
203 0.23
204 0.18
205 0.17
206 0.16
207 0.13
208 0.13
209 0.17
210 0.2
211 0.23
212 0.26
213 0.27
214 0.29
215 0.31
216 0.36
217 0.36
218 0.35
219 0.35
220 0.4
221 0.41
222 0.4
223 0.39
224 0.39
225 0.4
226 0.4
227 0.36
228 0.27
229 0.28
230 0.26
231 0.28
232 0.29
233 0.28
234 0.3
235 0.33
236 0.37
237 0.38
238 0.42
239 0.45
240 0.47
241 0.55
242 0.59
243 0.66
244 0.69
245 0.73
246 0.78
247 0.8
248 0.81