Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75D26

Protein Details
Accession Q75D26    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
221-244GETECYGYIKKQKRRKRKLEKKKQBasic
NLS Segment(s)
PositionSequence
230-244KKQKRRKRKLEKKKQ
Subcellular Location(s) plas 17, E.R. 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004728  Sec62  
IPR011553  Sec62_asco  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0031207  C:Sec62/Sec63 complex  
GO:0071256  C:translocon complex  
GO:0008320  F:protein transmembrane transporter activity  
GO:0031204  P:post-translational protein targeting to membrane, translocation  
KEGG ago:AGOS_ABR196C  -  
Pfam View protein in Pfam  
PF03839  Sec62  
Amino Acid Sequences MSDPESPLWVATLLRHHKELKQRQGMFQSRHMEFFRFKRFVRALNSDEYRAKSEREPEKYPPVRSEEDARDVFVSLIKAQLVLPCTKLHTAQCREHGLAPSKDYPHLLLSTKATLDADEYYVWTHNPKTLTDYLTVVGVIVGILAFVCYPLWPHSMKRVVYYLSLGLLGLLAVFSALALVRFVIYVLSLAFCSERGGFWIFPNLFEDCGVIASFKPLYGFGETECYGYIKKQKRRKRKLEKKKQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.37
4 0.42
5 0.53
6 0.6
7 0.61
8 0.64
9 0.64
10 0.67
11 0.74
12 0.76
13 0.7
14 0.68
15 0.65
16 0.56
17 0.58
18 0.53
19 0.46
20 0.43
21 0.46
22 0.48
23 0.45
24 0.44
25 0.49
26 0.5
27 0.52
28 0.54
29 0.54
30 0.47
31 0.51
32 0.53
33 0.48
34 0.48
35 0.45
36 0.41
37 0.36
38 0.35
39 0.3
40 0.36
41 0.41
42 0.44
43 0.47
44 0.48
45 0.58
46 0.61
47 0.61
48 0.56
49 0.53
50 0.5
51 0.47
52 0.48
53 0.42
54 0.42
55 0.39
56 0.36
57 0.3
58 0.27
59 0.25
60 0.19
61 0.16
62 0.09
63 0.1
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.11
70 0.12
71 0.12
72 0.14
73 0.15
74 0.17
75 0.19
76 0.26
77 0.31
78 0.34
79 0.39
80 0.41
81 0.41
82 0.41
83 0.42
84 0.39
85 0.34
86 0.33
87 0.31
88 0.29
89 0.28
90 0.26
91 0.22
92 0.18
93 0.18
94 0.16
95 0.14
96 0.14
97 0.14
98 0.13
99 0.13
100 0.11
101 0.09
102 0.09
103 0.08
104 0.07
105 0.06
106 0.07
107 0.07
108 0.07
109 0.07
110 0.07
111 0.07
112 0.09
113 0.1
114 0.1
115 0.14
116 0.16
117 0.18
118 0.18
119 0.18
120 0.16
121 0.15
122 0.14
123 0.09
124 0.07
125 0.05
126 0.04
127 0.03
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.04
137 0.06
138 0.08
139 0.1
140 0.11
141 0.19
142 0.25
143 0.26
144 0.27
145 0.28
146 0.27
147 0.26
148 0.26
149 0.19
150 0.14
151 0.13
152 0.1
153 0.08
154 0.06
155 0.05
156 0.04
157 0.03
158 0.02
159 0.02
160 0.02
161 0.02
162 0.02
163 0.02
164 0.03
165 0.03
166 0.03
167 0.03
168 0.04
169 0.04
170 0.04
171 0.04
172 0.04
173 0.04
174 0.05
175 0.05
176 0.05
177 0.06
178 0.06
179 0.08
180 0.08
181 0.07
182 0.1
183 0.13
184 0.14
185 0.14
186 0.23
187 0.21
188 0.22
189 0.24
190 0.22
191 0.2
192 0.19
193 0.19
194 0.1
195 0.11
196 0.1
197 0.08
198 0.07
199 0.1
200 0.1
201 0.1
202 0.1
203 0.1
204 0.12
205 0.14
206 0.15
207 0.13
208 0.19
209 0.19
210 0.19
211 0.19
212 0.18
213 0.16
214 0.21
215 0.3
216 0.34
217 0.43
218 0.53
219 0.63
220 0.73
221 0.84
222 0.9
223 0.92
224 0.94