Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q75CW1

Protein Details
Accession Q75CW1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
19-45HSTWKMKKPLRSCVRCRKNKIKCDSATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG ago:AGOS_ACL195C  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MADSGSDSHGDKRAAGYVHSTWKMKKPLRSCVRCRKNKIKCDSATRRPKPCSSCLKKGVGCELEYVIPPQRSKELRSLYENVAYVRLKLNELMESCDQLLDYCHASVDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.22
5 0.29
6 0.32
7 0.33
8 0.32
9 0.39
10 0.48
11 0.49
12 0.53
13 0.52
14 0.59
15 0.67
16 0.74
17 0.76
18 0.77
19 0.83
20 0.84
21 0.87
22 0.87
23 0.86
24 0.86
25 0.84
26 0.82
27 0.76
28 0.77
29 0.77
30 0.77
31 0.78
32 0.76
33 0.76
34 0.71
35 0.72
36 0.65
37 0.64
38 0.64
39 0.61
40 0.62
41 0.59
42 0.61
43 0.56
44 0.53
45 0.51
46 0.42
47 0.35
48 0.27
49 0.23
50 0.18
51 0.17
52 0.17
53 0.15
54 0.15
55 0.15
56 0.15
57 0.21
58 0.22
59 0.25
60 0.32
61 0.34
62 0.36
63 0.41
64 0.44
65 0.4
66 0.41
67 0.39
68 0.32
69 0.3
70 0.26
71 0.22
72 0.22
73 0.21
74 0.18
75 0.19
76 0.2
77 0.2
78 0.2
79 0.24
80 0.22
81 0.23
82 0.22
83 0.2
84 0.19
85 0.14
86 0.16
87 0.13
88 0.14
89 0.12