Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E716

Protein Details
Accession A5E716    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-43MKERERERERKKKEKISRSKWLETKVFRKPSKAGKVRRINIATBasic
288-313LKGKLLVSKKYPTRPRPQSKEAKEAVHydrophilic
NLS Segment(s)
PositionSequence
4-38RERERERKKKEKISRSKWLETKVFRKPSKAGKVRR
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000456  Ribosomal_L17  
IPR036373  Ribosomal_L17_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lel:LELG_05405  -  
Pfam View protein in Pfam  
PF01196  Ribosomal_L17  
Amino Acid Sequences MKERERERERKKKEKISRSKWLETKVFRKPSKAGKVRRINIATEPVSAQDKKKGSENKMRIDNTPKNVARHTKQIIKNLAANVIRNEYIVTTLGRARKAQPKIERLLANAMHQIKTNKFVPSLHREHSAGEPVPKAWDTVSALRFLQIPDQEECGNKVINELAQRYSNRTHGFTRVIKLEPRLGEDKAPMSVIELVDSKYEIKFWFTAKAVAKMELQNIPLDDITELNVKKLTERRPGGEEAFRDAVETCKREFFKQGAEGEEKQEVDEKVKRLLESLPYMERHTGSLKGKLLVSKKYPTRPRPQSKEAKEAVIPPSPFIKPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.92
2 0.93
3 0.91
4 0.92
5 0.9
6 0.89
7 0.85
8 0.82
9 0.8
10 0.77
11 0.77
12 0.76
13 0.77
14 0.7
15 0.7
16 0.69
17 0.7
18 0.73
19 0.74
20 0.73
21 0.73
22 0.81
23 0.8
24 0.83
25 0.76
26 0.67
27 0.63
28 0.61
29 0.52
30 0.42
31 0.38
32 0.3
33 0.32
34 0.32
35 0.29
36 0.29
37 0.3
38 0.3
39 0.38
40 0.45
41 0.48
42 0.56
43 0.62
44 0.63
45 0.69
46 0.69
47 0.66
48 0.67
49 0.66
50 0.6
51 0.63
52 0.58
53 0.52
54 0.56
55 0.59
56 0.53
57 0.55
58 0.56
59 0.55
60 0.57
61 0.62
62 0.62
63 0.56
64 0.57
65 0.49
66 0.49
67 0.41
68 0.37
69 0.31
70 0.28
71 0.24
72 0.2
73 0.19
74 0.13
75 0.13
76 0.12
77 0.1
78 0.09
79 0.13
80 0.16
81 0.18
82 0.19
83 0.24
84 0.31
85 0.36
86 0.43
87 0.47
88 0.51
89 0.53
90 0.58
91 0.54
92 0.47
93 0.48
94 0.41
95 0.34
96 0.33
97 0.3
98 0.24
99 0.25
100 0.26
101 0.21
102 0.25
103 0.26
104 0.22
105 0.21
106 0.23
107 0.27
108 0.33
109 0.37
110 0.35
111 0.35
112 0.34
113 0.34
114 0.34
115 0.32
116 0.25
117 0.22
118 0.2
119 0.17
120 0.18
121 0.16
122 0.15
123 0.1
124 0.11
125 0.12
126 0.17
127 0.17
128 0.17
129 0.17
130 0.17
131 0.18
132 0.15
133 0.16
134 0.12
135 0.14
136 0.14
137 0.16
138 0.16
139 0.16
140 0.17
141 0.15
142 0.13
143 0.11
144 0.1
145 0.09
146 0.09
147 0.11
148 0.11
149 0.11
150 0.14
151 0.15
152 0.18
153 0.19
154 0.23
155 0.22
156 0.24
157 0.24
158 0.24
159 0.29
160 0.28
161 0.29
162 0.27
163 0.27
164 0.27
165 0.27
166 0.27
167 0.23
168 0.24
169 0.24
170 0.22
171 0.21
172 0.2
173 0.19
174 0.16
175 0.15
176 0.11
177 0.1
178 0.11
179 0.09
180 0.09
181 0.09
182 0.09
183 0.09
184 0.1
185 0.09
186 0.07
187 0.09
188 0.08
189 0.1
190 0.11
191 0.12
192 0.16
193 0.15
194 0.22
195 0.23
196 0.28
197 0.27
198 0.27
199 0.28
200 0.26
201 0.28
202 0.24
203 0.23
204 0.18
205 0.17
206 0.16
207 0.14
208 0.13
209 0.1
210 0.08
211 0.09
212 0.13
213 0.12
214 0.12
215 0.14
216 0.14
217 0.18
218 0.24
219 0.29
220 0.34
221 0.38
222 0.4
223 0.43
224 0.46
225 0.46
226 0.45
227 0.39
228 0.35
229 0.33
230 0.29
231 0.26
232 0.22
233 0.24
234 0.24
235 0.25
236 0.21
237 0.26
238 0.28
239 0.3
240 0.34
241 0.31
242 0.33
243 0.37
244 0.38
245 0.36
246 0.4
247 0.39
248 0.38
249 0.38
250 0.31
251 0.25
252 0.28
253 0.23
254 0.24
255 0.28
256 0.27
257 0.3
258 0.33
259 0.32
260 0.29
261 0.32
262 0.32
263 0.32
264 0.34
265 0.33
266 0.32
267 0.34
268 0.35
269 0.32
270 0.29
271 0.26
272 0.29
273 0.28
274 0.33
275 0.33
276 0.33
277 0.35
278 0.39
279 0.41
280 0.42
281 0.44
282 0.47
283 0.52
284 0.59
285 0.68
286 0.71
287 0.77
288 0.8
289 0.86
290 0.86
291 0.88
292 0.89
293 0.86
294 0.87
295 0.79
296 0.74
297 0.65
298 0.61
299 0.56
300 0.53
301 0.45
302 0.37
303 0.39