Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5DY37

Protein Details
Accession A5DY37   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-134LAEKVEKASRQQRKQKKNREKKIFGTQRKAQKKAAKRNADHydrophilic
NLS Segment(s)
PositionSequence
101-132KASRQQRKQKKNREKKIFGTQRKAQKKAAKRN
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG lel:LELG_02274  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences SDAVTIRTRKVITNPLLARRQFVIDVLHPGRANVSKDELREKLSQIYKAEKDAVSVFGFRTQYGGGKSTGFGLIYQSVADLKKFEPAYRLVRYGLAEKVEKASRQQRKQKKNREKKIFGTQRKAQKKAAKRNAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.59
4 0.56
5 0.53
6 0.45
7 0.43
8 0.33
9 0.3
10 0.25
11 0.19
12 0.27
13 0.26
14 0.28
15 0.25
16 0.24
17 0.26
18 0.26
19 0.26
20 0.2
21 0.25
22 0.23
23 0.26
24 0.31
25 0.3
26 0.3
27 0.3
28 0.3
29 0.32
30 0.33
31 0.34
32 0.31
33 0.36
34 0.33
35 0.33
36 0.34
37 0.27
38 0.25
39 0.22
40 0.22
41 0.16
42 0.15
43 0.13
44 0.14
45 0.14
46 0.12
47 0.13
48 0.1
49 0.12
50 0.12
51 0.13
52 0.1
53 0.1
54 0.11
55 0.1
56 0.11
57 0.09
58 0.07
59 0.07
60 0.07
61 0.07
62 0.06
63 0.06
64 0.07
65 0.07
66 0.07
67 0.07
68 0.07
69 0.13
70 0.13
71 0.14
72 0.15
73 0.2
74 0.26
75 0.27
76 0.29
77 0.24
78 0.25
79 0.26
80 0.26
81 0.24
82 0.21
83 0.19
84 0.18
85 0.22
86 0.23
87 0.22
88 0.26
89 0.34
90 0.41
91 0.5
92 0.6
93 0.66
94 0.74
95 0.84
96 0.89
97 0.91
98 0.92
99 0.94
100 0.94
101 0.92
102 0.89
103 0.9
104 0.89
105 0.87
106 0.86
107 0.82
108 0.82
109 0.84
110 0.8
111 0.78
112 0.77
113 0.78
114 0.8