Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q754R8

Protein Details
Accession Q754R8   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
340-381IEKREIEKERNMRRLKRESAKVDDRLARRRGKRRMDDLETTMBasic
NLS Segment(s)
PositionSequence
346-373EKERNMRRLKRESAKVDDRLARRRGKRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017393  Sfh1/SNF5  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0005634  C:nucleus  
GO:0016586  C:RSC-type complex  
GO:0003712  F:transcription coregulator activity  
GO:0006338  P:chromatin remodeling  
GO:0031055  P:chromatin remodeling at centromere  
GO:0007059  P:chromosome segregation  
GO:0006302  P:double-strand break repair  
GO:0000086  P:G2/M transition of mitotic cell cycle  
GO:0006337  P:nucleosome disassembly  
GO:1900461  P:positive regulation of pseudohyphal growth by positive regulation of transcription from RNA polymerase II promoter  
GO:0033262  P:regulation of nuclear cell cycle DNA replication  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG ago:AGOS_AFR004W  -  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MSQLLPQAYLTNFHNRIRNEDVPLFITAAPTRNHKRAKVVNYSEYDNDLLLDDFIEQDQNDDDEKVHSDNGKGEGEEVGHEDAVASNNNLPDLEQQDDPTGILRYPRIRETFLQSKIAVRYEQVLEAGVGGSGEAVGIAEDEGAGAYSSSSQPVVIPIRLNLEHNGHKIIDFFTWNLNDHSLTLEQFAQIYCQDLDFAHNLSLQNQIVAAINDQLQEYETLASVVVPDLHVIINLTCNLDSKLYEDNFEWNLNDQTLSPEQFAELVVQDLGLTREFMPAIAHALYESILKIKKDWLEGHLNPEHVANGAAFGCLSGIRLDIDTLGSNWCPKVEVLSQWEIEKREIEKERNMRRLKRESAKVDDRLARRRGKRRMDDLETTMRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.4
3 0.46
4 0.51
5 0.52
6 0.49
7 0.47
8 0.46
9 0.41
10 0.41
11 0.36
12 0.28
13 0.26
14 0.21
15 0.23
16 0.22
17 0.29
18 0.35
19 0.42
20 0.48
21 0.49
22 0.57
23 0.61
24 0.68
25 0.7
26 0.71
27 0.7
28 0.66
29 0.67
30 0.59
31 0.52
32 0.44
33 0.33
34 0.26
35 0.19
36 0.16
37 0.11
38 0.1
39 0.07
40 0.07
41 0.07
42 0.09
43 0.07
44 0.08
45 0.09
46 0.1
47 0.11
48 0.11
49 0.12
50 0.12
51 0.14
52 0.14
53 0.16
54 0.16
55 0.17
56 0.19
57 0.23
58 0.22
59 0.2
60 0.2
61 0.18
62 0.17
63 0.16
64 0.15
65 0.12
66 0.1
67 0.1
68 0.09
69 0.09
70 0.1
71 0.1
72 0.09
73 0.1
74 0.1
75 0.11
76 0.11
77 0.11
78 0.12
79 0.14
80 0.16
81 0.15
82 0.15
83 0.16
84 0.17
85 0.16
86 0.15
87 0.12
88 0.1
89 0.12
90 0.14
91 0.18
92 0.21
93 0.27
94 0.28
95 0.31
96 0.33
97 0.4
98 0.44
99 0.42
100 0.43
101 0.37
102 0.39
103 0.38
104 0.37
105 0.29
106 0.21
107 0.21
108 0.19
109 0.19
110 0.15
111 0.13
112 0.11
113 0.1
114 0.1
115 0.06
116 0.05
117 0.04
118 0.03
119 0.03
120 0.02
121 0.02
122 0.02
123 0.02
124 0.02
125 0.02
126 0.02
127 0.02
128 0.02
129 0.02
130 0.03
131 0.03
132 0.02
133 0.03
134 0.04
135 0.04
136 0.05
137 0.05
138 0.05
139 0.05
140 0.09
141 0.11
142 0.11
143 0.12
144 0.12
145 0.16
146 0.16
147 0.18
148 0.16
149 0.18
150 0.2
151 0.21
152 0.22
153 0.18
154 0.18
155 0.17
156 0.16
157 0.13
158 0.11
159 0.1
160 0.11
161 0.12
162 0.13
163 0.13
164 0.13
165 0.12
166 0.11
167 0.12
168 0.1
169 0.09
170 0.09
171 0.09
172 0.08
173 0.08
174 0.08
175 0.07
176 0.06
177 0.07
178 0.06
179 0.06
180 0.06
181 0.06
182 0.08
183 0.08
184 0.09
185 0.08
186 0.09
187 0.1
188 0.1
189 0.13
190 0.11
191 0.1
192 0.09
193 0.09
194 0.08
195 0.08
196 0.08
197 0.06
198 0.07
199 0.07
200 0.07
201 0.07
202 0.06
203 0.06
204 0.07
205 0.06
206 0.05
207 0.05
208 0.05
209 0.05
210 0.05
211 0.04
212 0.04
213 0.04
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.05
220 0.06
221 0.06
222 0.07
223 0.07
224 0.08
225 0.08
226 0.09
227 0.09
228 0.1
229 0.15
230 0.15
231 0.16
232 0.16
233 0.18
234 0.19
235 0.2
236 0.18
237 0.14
238 0.15
239 0.14
240 0.14
241 0.11
242 0.13
243 0.15
244 0.15
245 0.14
246 0.13
247 0.13
248 0.12
249 0.13
250 0.09
251 0.07
252 0.07
253 0.06
254 0.06
255 0.06
256 0.06
257 0.07
258 0.06
259 0.07
260 0.07
261 0.08
262 0.08
263 0.09
264 0.09
265 0.08
266 0.1
267 0.09
268 0.08
269 0.07
270 0.07
271 0.08
272 0.08
273 0.08
274 0.09
275 0.12
276 0.12
277 0.13
278 0.18
279 0.21
280 0.26
281 0.28
282 0.29
283 0.36
284 0.37
285 0.43
286 0.41
287 0.39
288 0.34
289 0.32
290 0.27
291 0.18
292 0.17
293 0.1
294 0.08
295 0.08
296 0.08
297 0.07
298 0.06
299 0.06
300 0.06
301 0.07
302 0.05
303 0.06
304 0.06
305 0.07
306 0.07
307 0.07
308 0.09
309 0.09
310 0.09
311 0.11
312 0.11
313 0.13
314 0.13
315 0.13
316 0.13
317 0.12
318 0.17
319 0.18
320 0.23
321 0.27
322 0.31
323 0.32
324 0.34
325 0.38
326 0.35
327 0.33
328 0.32
329 0.28
330 0.32
331 0.38
332 0.41
333 0.47
334 0.55
335 0.63
336 0.69
337 0.76
338 0.75
339 0.78
340 0.82
341 0.82
342 0.82
343 0.82
344 0.8
345 0.81
346 0.81
347 0.77
348 0.75
349 0.73
350 0.7
351 0.69
352 0.7
353 0.69
354 0.7
355 0.76
356 0.78
357 0.81
358 0.84
359 0.85
360 0.87
361 0.85
362 0.82
363 0.79