Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4R8QPV5

Protein Details
Accession A0A4R8QPV5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
78-103GLAGVLLWRRRRRRRRERIEDILPMPHydrophilic
NLS Segment(s)
PositionSequence
86-95RRRRRRRRER
Subcellular Location(s) mito 9, cyto 6, extr 6, mito_nucl 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVTIPAPLAVQTIGPPIGNGAANNQPPSSGGSGSGSSSGSGSSSSVQVSLNQGDSLIKTAGIVAFSFFGGVVAASAIGLAGVLLWRRRRRRRRERIEDILPMPMHHHQDVTVPEVVYSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.09
4 0.11
5 0.11
6 0.11
7 0.12
8 0.17
9 0.2
10 0.22
11 0.21
12 0.19
13 0.19
14 0.22
15 0.2
16 0.14
17 0.12
18 0.13
19 0.14
20 0.14
21 0.14
22 0.11
23 0.1
24 0.09
25 0.08
26 0.07
27 0.06
28 0.06
29 0.06
30 0.07
31 0.07
32 0.07
33 0.07
34 0.08
35 0.1
36 0.1
37 0.1
38 0.09
39 0.09
40 0.09
41 0.08
42 0.09
43 0.07
44 0.06
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.04
51 0.05
52 0.05
53 0.05
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.04
70 0.08
71 0.15
72 0.24
73 0.34
74 0.45
75 0.56
76 0.67
77 0.77
78 0.85
79 0.9
80 0.93
81 0.93
82 0.91
83 0.88
84 0.83
85 0.73
86 0.68
87 0.57
88 0.46
89 0.4
90 0.35
91 0.33
92 0.26
93 0.26
94 0.2
95 0.24
96 0.26
97 0.27
98 0.25
99 0.21