Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4V3HU33

Protein Details
Accession A0A4V3HU33    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-73CSFTASKKKKSVKCPSLPNKTCTHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 10, mito 6, cyto 5, mito_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023112  Antifungal-protein_dom_sf  
IPR022706  Antifungal_prot  
Gene Ontology GO:0050832  P:defense response to fungus  
Pfam View protein in Pfam  
PF11402  Antifungal_prot  
Amino Acid Sequences MLFFNNFVFLLAAMGAIASPVQPNSNDVGPADLEGDGITYTGKCTRKTNECSFTASKKKKSVKCPSLPNKTCTKDGAKCTYDILSQEIVCY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.04
3 0.03
4 0.03
5 0.03
6 0.04
7 0.04
8 0.06
9 0.06
10 0.08
11 0.11
12 0.12
13 0.12
14 0.11
15 0.12
16 0.11
17 0.11
18 0.1
19 0.07
20 0.07
21 0.06
22 0.06
23 0.05
24 0.04
25 0.04
26 0.03
27 0.04
28 0.1
29 0.13
30 0.14
31 0.18
32 0.23
33 0.31
34 0.38
35 0.45
36 0.45
37 0.44
38 0.49
39 0.49
40 0.5
41 0.53
42 0.52
43 0.51
44 0.54
45 0.61
46 0.63
47 0.7
48 0.75
49 0.74
50 0.76
51 0.81
52 0.82
53 0.85
54 0.82
55 0.76
56 0.74
57 0.68
58 0.62
59 0.56
60 0.54
61 0.5
62 0.53
63 0.57
64 0.5
65 0.47
66 0.46
67 0.44
68 0.38
69 0.32
70 0.28
71 0.22