Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4R8RR91

Protein Details
Accession A0A4R8RR91    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAPAAGAKKQKKKVRRISQSLSHREMHydrophilic
NLS Segment(s)
PositionSequence
7-19AKKQKKKVRRISQ
Subcellular Location(s) nucl 18, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGAKKQKKKVRRISQSLSHREMSKGKVKDKAQHAVILDKQTSDKLYKDVQSYRLVTVAVLVDRLKINGSLARKCLADLEEKGIIKPVVQHSKMKIYTRAVGGSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.87
4 0.86
5 0.87
6 0.88
7 0.85
8 0.78
9 0.7
10 0.6
11 0.54
12 0.5
13 0.45
14 0.44
15 0.42
16 0.41
17 0.46
18 0.48
19 0.52
20 0.55
21 0.56
22 0.49
23 0.47
24 0.44
25 0.4
26 0.39
27 0.34
28 0.28
29 0.21
30 0.2
31 0.18
32 0.18
33 0.15
34 0.13
35 0.13
36 0.16
37 0.18
38 0.21
39 0.23
40 0.24
41 0.27
42 0.27
43 0.25
44 0.23
45 0.2
46 0.16
47 0.14
48 0.12
49 0.08
50 0.07
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.07
57 0.08
58 0.11
59 0.15
60 0.16
61 0.18
62 0.2
63 0.19
64 0.19
65 0.21
66 0.18
67 0.2
68 0.18
69 0.22
70 0.25
71 0.25
72 0.25
73 0.26
74 0.24
75 0.19
76 0.23
77 0.28
78 0.32
79 0.35
80 0.4
81 0.41
82 0.5
83 0.56
84 0.55
85 0.53
86 0.48
87 0.51
88 0.5