Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YIF1

Protein Details
Accession A0A448YIF1   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
304-329LKDGSKLINSKKNTKKKERNGVVDGWHydrophilic
NLS Segment(s)
PositionSequence
297-321KKGNELRLKDGSKLINSKKNTKKKE
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017389  Nucleoporin_NUP53  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR007846  RRM_NUP35_dom  
Gene Ontology GO:0031965  C:nuclear membrane  
GO:0005643  C:nuclear pore  
GO:0003676  F:nucleic acid binding  
GO:0017056  F:structural constituent of nuclear pore  
GO:0051028  P:mRNA transport  
GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF05172  Nup35_RRM  
PROSITE View protein in PROSITE  
PS51472  RRM_NUP35  
Amino Acid Sequences MKPRTMPVTLIKRARKTSNESLEEDKTTIPVLPFKKRSPEQDNEAWKEAYDYADLPPKRSLFDFNRPNEDQVGSNLLIDTPDFADLAKRPDDYLNAFNRYTRSRVEAAKEVVGQQVGGGLPFEENKSHLPTTNPSSQNAATRSTTRPTPVESSVIIYGFNDSNFDLIIDHFTKFGTILEDFHNSLRRSRPNKMNYPIFMGEGWVKITYGNPGNAIRALRENDSIDDQGHIIGVVPYSRKGLEELLNRKIPDSLDVGNGLASLHIDPEEITFPEDSNGIGELLRKSFTMGVSVDEKGKKGNELRLKDGSKLINSKKNTKKKERNGVVDGWVRFMFGRGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.7
3 0.69
4 0.71
5 0.72
6 0.7
7 0.66
8 0.65
9 0.61
10 0.57
11 0.49
12 0.39
13 0.29
14 0.24
15 0.23
16 0.18
17 0.21
18 0.25
19 0.33
20 0.39
21 0.43
22 0.52
23 0.55
24 0.63
25 0.65
26 0.67
27 0.64
28 0.67
29 0.72
30 0.68
31 0.67
32 0.57
33 0.48
34 0.43
35 0.36
36 0.29
37 0.21
38 0.16
39 0.14
40 0.23
41 0.23
42 0.24
43 0.28
44 0.27
45 0.28
46 0.28
47 0.34
48 0.33
49 0.43
50 0.49
51 0.49
52 0.57
53 0.56
54 0.57
55 0.51
56 0.45
57 0.35
58 0.28
59 0.28
60 0.2
61 0.18
62 0.16
63 0.14
64 0.13
65 0.11
66 0.11
67 0.06
68 0.07
69 0.06
70 0.06
71 0.09
72 0.11
73 0.14
74 0.15
75 0.15
76 0.16
77 0.17
78 0.2
79 0.21
80 0.27
81 0.29
82 0.31
83 0.3
84 0.31
85 0.33
86 0.33
87 0.31
88 0.26
89 0.26
90 0.25
91 0.29
92 0.32
93 0.34
94 0.34
95 0.34
96 0.32
97 0.28
98 0.26
99 0.22
100 0.17
101 0.11
102 0.1
103 0.07
104 0.07
105 0.06
106 0.05
107 0.05
108 0.06
109 0.07
110 0.06
111 0.08
112 0.1
113 0.14
114 0.14
115 0.15
116 0.17
117 0.2
118 0.25
119 0.33
120 0.32
121 0.29
122 0.32
123 0.32
124 0.34
125 0.32
126 0.29
127 0.22
128 0.24
129 0.25
130 0.24
131 0.24
132 0.22
133 0.22
134 0.22
135 0.24
136 0.22
137 0.22
138 0.19
139 0.2
140 0.18
141 0.17
142 0.14
143 0.1
144 0.1
145 0.09
146 0.08
147 0.07
148 0.06
149 0.06
150 0.06
151 0.06
152 0.05
153 0.04
154 0.08
155 0.08
156 0.08
157 0.08
158 0.08
159 0.08
160 0.08
161 0.08
162 0.07
163 0.06
164 0.08
165 0.1
166 0.12
167 0.12
168 0.13
169 0.19
170 0.18
171 0.21
172 0.25
173 0.32
174 0.35
175 0.42
176 0.5
177 0.52
178 0.61
179 0.65
180 0.65
181 0.57
182 0.58
183 0.51
184 0.42
185 0.34
186 0.27
187 0.2
188 0.15
189 0.15
190 0.09
191 0.08
192 0.08
193 0.08
194 0.11
195 0.12
196 0.12
197 0.13
198 0.14
199 0.15
200 0.17
201 0.17
202 0.14
203 0.15
204 0.17
205 0.17
206 0.18
207 0.18
208 0.18
209 0.2
210 0.2
211 0.16
212 0.15
213 0.13
214 0.11
215 0.1
216 0.08
217 0.06
218 0.05
219 0.05
220 0.06
221 0.07
222 0.07
223 0.09
224 0.09
225 0.09
226 0.1
227 0.13
228 0.18
229 0.26
230 0.31
231 0.36
232 0.4
233 0.4
234 0.39
235 0.37
236 0.31
237 0.25
238 0.23
239 0.18
240 0.16
241 0.16
242 0.16
243 0.14
244 0.14
245 0.11
246 0.08
247 0.07
248 0.05
249 0.05
250 0.05
251 0.05
252 0.05
253 0.07
254 0.09
255 0.09
256 0.1
257 0.1
258 0.1
259 0.11
260 0.11
261 0.09
262 0.08
263 0.09
264 0.07
265 0.08
266 0.1
267 0.11
268 0.12
269 0.13
270 0.12
271 0.13
272 0.15
273 0.15
274 0.16
275 0.14
276 0.16
277 0.18
278 0.2
279 0.24
280 0.23
281 0.24
282 0.24
283 0.25
284 0.28
285 0.3
286 0.38
287 0.42
288 0.46
289 0.52
290 0.57
291 0.58
292 0.55
293 0.56
294 0.51
295 0.48
296 0.52
297 0.54
298 0.53
299 0.56
300 0.64
301 0.69
302 0.74
303 0.78
304 0.81
305 0.84
306 0.87
307 0.93
308 0.92
309 0.91
310 0.86
311 0.8
312 0.76
313 0.73
314 0.62
315 0.55
316 0.45
317 0.37
318 0.3
319 0.28