Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YF38

Protein Details
Accession A0A448YF38   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-32MVNVPKTRKTYCKGKKCRKHTQHRVTQYKAGKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 8, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKKCRKHTQHRVTQYKAGKASLYAQGKRRYDRKQSGYGGQTKQVFHRKAKTTKKVVLRLECVVCKTKMQLPLKRCKHFELGGDKKQKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.88
4 0.93
5 0.92
6 0.93
7 0.93
8 0.93
9 0.92
10 0.93
11 0.92
12 0.85
13 0.82
14 0.76
15 0.71
16 0.62
17 0.52
18 0.42
19 0.34
20 0.32
21 0.32
22 0.32
23 0.3
24 0.35
25 0.41
26 0.44
27 0.48
28 0.53
29 0.52
30 0.56
31 0.61
32 0.61
33 0.61
34 0.61
35 0.61
36 0.59
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.38
44 0.37
45 0.34
46 0.41
47 0.45
48 0.52
49 0.61
50 0.65
51 0.63
52 0.67
53 0.72
54 0.72
55 0.71
56 0.67
57 0.61
58 0.57
59 0.53
60 0.47
61 0.42
62 0.38
63 0.31
64 0.27
65 0.26
66 0.26
67 0.32
68 0.39
69 0.43
70 0.47
71 0.57
72 0.66
73 0.7
74 0.68
75 0.64
76 0.63
77 0.59
78 0.59
79 0.59
80 0.59
81 0.61
82 0.66
83 0.62
84 0.56
85 0.55
86 0.49