Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YLD8

Protein Details
Accession A0A448YLD8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
14-44KLETAEKFKKPDRKRGKRKYKSTRQVMNDESBasic
NLS Segment(s)
PositionSequence
20-34KFKKPDRKRGKRKYK
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029525  INO80C/Ies6  
IPR013272  Vps72/YL1_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF08265  YL1_C  
Amino Acid Sequences MPFEHDDLGKVMDKLETAEKFKKPDRKRGKRKYKSTRQVMNDESKRVQQKRDESEKPFTNMITYQSLTAPPSLKPVKTYCDITGLPTNYKSPNTRIRFFDKECYDLVKSLPPGVDQQYLALRNANVVLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.21
3 0.21
4 0.25
5 0.32
6 0.34
7 0.39
8 0.47
9 0.55
10 0.55
11 0.62
12 0.68
13 0.73
14 0.81
15 0.86
16 0.91
17 0.91
18 0.95
19 0.95
20 0.95
21 0.94
22 0.93
23 0.91
24 0.85
25 0.82
26 0.76
27 0.75
28 0.67
29 0.61
30 0.52
31 0.49
32 0.52
33 0.47
34 0.46
35 0.42
36 0.47
37 0.52
38 0.59
39 0.59
40 0.56
41 0.61
42 0.59
43 0.55
44 0.47
45 0.38
46 0.31
47 0.25
48 0.23
49 0.18
50 0.15
51 0.13
52 0.12
53 0.13
54 0.12
55 0.13
56 0.11
57 0.09
58 0.15
59 0.17
60 0.17
61 0.19
62 0.21
63 0.23
64 0.25
65 0.28
66 0.22
67 0.26
68 0.25
69 0.26
70 0.3
71 0.28
72 0.26
73 0.24
74 0.26
75 0.23
76 0.26
77 0.26
78 0.26
79 0.34
80 0.39
81 0.42
82 0.45
83 0.51
84 0.55
85 0.55
86 0.59
87 0.52
88 0.49
89 0.45
90 0.45
91 0.39
92 0.33
93 0.3
94 0.27
95 0.24
96 0.24
97 0.24
98 0.2
99 0.22
100 0.25
101 0.27
102 0.21
103 0.23
104 0.26
105 0.27
106 0.27
107 0.26
108 0.22
109 0.21