Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A448YEW2

Protein Details
Accession A0A448YEW2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
7-32AKTLAKRKASKDNKVKQQQQNAPNSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, extr 5, cyto 4, E.R. 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR030671  Sec61-beta/Sbh  
IPR016482  SecG/Sec61-beta/Sbh  
Gene Ontology GO:0005784  C:Sec61 translocon complex  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF03911  Sec61_beta  
Amino Acid Sequences MVIPGGAKTLAKRKASKDNKVKQQQQNAPNSSRSAGAGGSSSTMLKIYTDEAQGFKIDPLVVLIFAVAFIFSVVILHVLSKLSGKLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.7
4 0.72
5 0.75
6 0.79
7 0.84
8 0.88
9 0.85
10 0.86
11 0.84
12 0.82
13 0.81
14 0.75
15 0.68
16 0.6
17 0.53
18 0.43
19 0.35
20 0.27
21 0.18
22 0.13
23 0.1
24 0.09
25 0.07
26 0.07
27 0.07
28 0.06
29 0.05
30 0.06
31 0.05
32 0.05
33 0.05
34 0.06
35 0.07
36 0.09
37 0.1
38 0.1
39 0.11
40 0.11
41 0.11
42 0.09
43 0.09
44 0.08
45 0.07
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.04
62 0.04
63 0.05
64 0.05
65 0.06
66 0.07
67 0.08