Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YGT9

Protein Details
Accession A0A448YGT9    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
70-92EVIPKERERKRHIRKLNEYNELKBasic
NLS Segment(s)
PositionSequence
78-80RKR
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010760  DNA-repair_Swi5  
Gene Ontology GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF07061  Swi5  
Amino Acid Sequences MEDLDSSPTLEGTSISEEDISFEWAIDYSADAGTSKKLEADWSILQELKGKCRNLMDELGIKDAKVIDSEVIPKERERKRHIRKLNEYNELKDAAMQLISMIAEQRSLKINDVMKEMGVEKDKEETDKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.12
4 0.12
5 0.13
6 0.13
7 0.14
8 0.1
9 0.1
10 0.1
11 0.09
12 0.1
13 0.08
14 0.08
15 0.06
16 0.06
17 0.06
18 0.06
19 0.07
20 0.08
21 0.09
22 0.08
23 0.08
24 0.08
25 0.1
26 0.11
27 0.15
28 0.15
29 0.16
30 0.18
31 0.18
32 0.18
33 0.23
34 0.22
35 0.24
36 0.29
37 0.27
38 0.27
39 0.28
40 0.3
41 0.27
42 0.28
43 0.23
44 0.21
45 0.21
46 0.23
47 0.2
48 0.18
49 0.15
50 0.14
51 0.11
52 0.08
53 0.07
54 0.05
55 0.06
56 0.08
57 0.1
58 0.11
59 0.12
60 0.13
61 0.22
62 0.26
63 0.33
64 0.39
65 0.48
66 0.57
67 0.67
68 0.74
69 0.76
70 0.82
71 0.85
72 0.85
73 0.83
74 0.75
75 0.68
76 0.61
77 0.51
78 0.41
79 0.31
80 0.24
81 0.15
82 0.12
83 0.09
84 0.07
85 0.06
86 0.06
87 0.05
88 0.06
89 0.05
90 0.07
91 0.08
92 0.1
93 0.14
94 0.15
95 0.17
96 0.22
97 0.27
98 0.27
99 0.31
100 0.3
101 0.25
102 0.26
103 0.25
104 0.24
105 0.23
106 0.22
107 0.19
108 0.24
109 0.25