Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YLV3

Protein Details
Accession A0A448YLV3   
Localization Confidence Medium
Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
286-310NESGGKKRKPVGKKQKVVKRVAVGKBasic
NLS Segment(s)
PositionSequence
290-307GKKRKPVGKKQKVVKRVA
Subcellular Location(s) nucl 19, cyto_nucl 13.333, mito_nucl 10.333, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040456  RNase_H2_suB  
IPR019024  RNase_H2_suB_wHTH  
Gene Ontology GO:0032299  C:ribonuclease H2 complex  
Pfam View protein in Pfam  
PF09468  RNase_H2-Ydr279  
Amino Acid Sequences MTAEEVLTEVDRNSFKLVLLPNSRSTYTSLKLKNPVGQEIGEYLISQPEGKLYSLNKTDFKDSYNEKQRLTKNSQPLTSLLLTRSVQSASPGCLLIGKAPEIYIATAFNQIYFLLSFFVAFLKQDHLRLLSYDDLMEKFEESETLESLISQGISFKGSLERICDTVEEGGETFHKVSKSKVIEYLKQRVTKIVGNFPASVGSQVTRKLTGNVSSGSLDLTDDIIRLSRTRSAINLLSSYVDDYYLRLLLKEYDFRTLDSYMEQLARIEEMNKVAEDNLQVLNERMNESGGKKRKPVGKKQKVVKRVAVGKGALDMFFKPRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.21
4 0.25
5 0.29
6 0.35
7 0.38
8 0.41
9 0.44
10 0.45
11 0.41
12 0.41
13 0.38
14 0.37
15 0.42
16 0.42
17 0.44
18 0.51
19 0.54
20 0.55
21 0.53
22 0.52
23 0.45
24 0.4
25 0.35
26 0.29
27 0.26
28 0.21
29 0.17
30 0.13
31 0.12
32 0.12
33 0.11
34 0.09
35 0.1
36 0.11
37 0.11
38 0.15
39 0.15
40 0.22
41 0.27
42 0.31
43 0.33
44 0.34
45 0.39
46 0.36
47 0.37
48 0.36
49 0.37
50 0.43
51 0.49
52 0.51
53 0.48
54 0.55
55 0.59
56 0.61
57 0.63
58 0.61
59 0.6
60 0.62
61 0.62
62 0.55
63 0.5
64 0.47
65 0.4
66 0.34
67 0.24
68 0.23
69 0.21
70 0.2
71 0.2
72 0.16
73 0.15
74 0.16
75 0.17
76 0.14
77 0.15
78 0.14
79 0.13
80 0.13
81 0.13
82 0.12
83 0.12
84 0.11
85 0.1
86 0.1
87 0.1
88 0.09
89 0.1
90 0.08
91 0.07
92 0.08
93 0.11
94 0.11
95 0.1
96 0.1
97 0.1
98 0.1
99 0.09
100 0.08
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.09
110 0.11
111 0.12
112 0.12
113 0.13
114 0.14
115 0.14
116 0.15
117 0.13
118 0.12
119 0.11
120 0.11
121 0.1
122 0.11
123 0.1
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.07
131 0.07
132 0.07
133 0.06
134 0.07
135 0.06
136 0.06
137 0.05
138 0.05
139 0.04
140 0.05
141 0.05
142 0.05
143 0.07
144 0.08
145 0.08
146 0.1
147 0.11
148 0.11
149 0.11
150 0.11
151 0.1
152 0.09
153 0.09
154 0.07
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.08
161 0.09
162 0.09
163 0.1
164 0.17
165 0.2
166 0.21
167 0.28
168 0.29
169 0.35
170 0.4
171 0.48
172 0.46
173 0.47
174 0.46
175 0.41
176 0.4
177 0.38
178 0.35
179 0.33
180 0.31
181 0.29
182 0.29
183 0.27
184 0.26
185 0.21
186 0.19
187 0.13
188 0.1
189 0.09
190 0.11
191 0.12
192 0.13
193 0.13
194 0.15
195 0.17
196 0.19
197 0.2
198 0.19
199 0.19
200 0.17
201 0.17
202 0.15
203 0.13
204 0.09
205 0.07
206 0.08
207 0.06
208 0.06
209 0.06
210 0.07
211 0.07
212 0.08
213 0.09
214 0.12
215 0.14
216 0.15
217 0.16
218 0.2
219 0.22
220 0.24
221 0.23
222 0.19
223 0.18
224 0.18
225 0.17
226 0.13
227 0.1
228 0.09
229 0.08
230 0.09
231 0.1
232 0.1
233 0.09
234 0.1
235 0.13
236 0.16
237 0.21
238 0.21
239 0.25
240 0.26
241 0.27
242 0.29
243 0.27
244 0.24
245 0.19
246 0.19
247 0.15
248 0.15
249 0.14
250 0.11
251 0.11
252 0.11
253 0.11
254 0.11
255 0.11
256 0.12
257 0.13
258 0.13
259 0.13
260 0.12
261 0.14
262 0.14
263 0.14
264 0.14
265 0.13
266 0.13
267 0.13
268 0.16
269 0.15
270 0.16
271 0.14
272 0.14
273 0.16
274 0.19
275 0.29
276 0.35
277 0.38
278 0.41
279 0.48
280 0.56
281 0.63
282 0.71
283 0.72
284 0.75
285 0.8
286 0.86
287 0.88
288 0.89
289 0.87
290 0.83
291 0.81
292 0.79
293 0.75
294 0.7
295 0.61
296 0.52
297 0.49
298 0.42
299 0.33
300 0.26
301 0.22