Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A448YTY1

Protein Details
Accession A0A448YTY1    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
19-38VQFVRKCRKPTKKEYVQLVRHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 8, mito 7, cyto_nucl 7, nucl 4, E.R. 4, plas 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR023391  Prot_translocase_SecE_dom_sf  
IPR008158  Translocase_Sec61-g  
IPR001901  Translocase_SecE/Sec61-g  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0008320  F:protein transmembrane transporter activity  
GO:0006605  P:protein targeting  
Pfam View protein in Pfam  
PF00584  SecE  
PROSITE View protein in PROSITE  
PS01067  SECE_SEC61G  
Amino Acid Sequences MAEKDKLTDAPVEFVKEGVQFVRKCRKPTKKEYVQLVRAVGIGFFMMGVVGYLIKLIHIPIRYLIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.16
4 0.16
5 0.14
6 0.19
7 0.17
8 0.23
9 0.34
10 0.37
11 0.42
12 0.52
13 0.61
14 0.62
15 0.71
16 0.76
17 0.75
18 0.78
19 0.81
20 0.79
21 0.72
22 0.66
23 0.56
24 0.45
25 0.36
26 0.29
27 0.19
28 0.11
29 0.07
30 0.05
31 0.04
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.03
40 0.03
41 0.04
42 0.04
43 0.05
44 0.1
45 0.11
46 0.12