Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A448YJF0

Protein Details
Accession A0A448YJF0    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
32-55AAAGSKKGKKKWSKGKVKDRAEHIBasic
NLS Segment(s)
PositionSequence
26-50AAKAAAAAAGSKKGKKKWSKGKVKD
Subcellular Location(s) mito 12, cyto 9.5, cyto_nucl 7.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MRKEEKQQQLMVGNWRMPVKVQATKAAKAAAAAAGSKKGKKKWSKGKVKDRAEHIVILDQEKYDRILKEVPTYRYISVSVLVDRLKIGGSVARVALAQLERDGVIKAVSKHSTQLIYTRATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.32
4 0.28
5 0.29
6 0.27
7 0.29
8 0.3
9 0.36
10 0.39
11 0.4
12 0.41
13 0.37
14 0.31
15 0.25
16 0.24
17 0.16
18 0.12
19 0.11
20 0.1
21 0.14
22 0.16
23 0.2
24 0.24
25 0.28
26 0.37
27 0.45
28 0.55
29 0.61
30 0.69
31 0.77
32 0.82
33 0.88
34 0.89
35 0.89
36 0.84
37 0.78
38 0.73
39 0.63
40 0.53
41 0.43
42 0.35
43 0.27
44 0.23
45 0.18
46 0.12
47 0.1
48 0.1
49 0.11
50 0.1
51 0.1
52 0.11
53 0.14
54 0.15
55 0.22
56 0.28
57 0.28
58 0.29
59 0.31
60 0.3
61 0.28
62 0.27
63 0.21
64 0.17
65 0.15
66 0.12
67 0.12
68 0.12
69 0.11
70 0.1
71 0.1
72 0.08
73 0.07
74 0.07
75 0.07
76 0.08
77 0.09
78 0.09
79 0.09
80 0.09
81 0.09
82 0.11
83 0.1
84 0.09
85 0.08
86 0.09
87 0.09
88 0.1
89 0.11
90 0.08
91 0.09
92 0.12
93 0.14
94 0.19
95 0.22
96 0.22
97 0.24
98 0.28
99 0.29
100 0.27
101 0.3
102 0.28