Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YH35

Protein Details
Accession A0A448YH35    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
10-37ASKAPAKKTTIEPKKRTKSRKETWSSYIHydrophilic
NLS Segment(s)
PositionSequence
4-30RAEKKPASKAPAKKTTIEPKKRTKSRK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPRAEKKPASKAPAKKTTIEPKKRTKSRKETWSSYIYKVLKQTHPDTGISQRAMSIMNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYTSSTSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.67
4 0.68
5 0.71
6 0.73
7 0.75
8 0.73
9 0.74
10 0.81
11 0.87
12 0.88
13 0.87
14 0.87
15 0.86
16 0.89
17 0.86
18 0.82
19 0.78
20 0.76
21 0.69
22 0.61
23 0.6
24 0.5
25 0.44
26 0.44
27 0.43
28 0.39
29 0.41
30 0.41
31 0.38
32 0.39
33 0.37
34 0.34
35 0.33
36 0.33
37 0.28
38 0.25
39 0.19
40 0.17
41 0.17
42 0.15
43 0.11
44 0.08
45 0.08
46 0.08
47 0.08
48 0.08
49 0.08
50 0.08
51 0.08
52 0.06
53 0.06
54 0.06
55 0.06
56 0.07
57 0.06
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.11
64 0.16
65 0.18
66 0.21
67 0.23
68 0.24
69 0.25
70 0.27
71 0.29
72 0.29
73 0.33
74 0.31
75 0.33
76 0.32
77 0.31
78 0.32
79 0.27
80 0.22
81 0.16
82 0.14
83 0.1
84 0.11
85 0.11
86 0.09
87 0.09
88 0.09
89 0.1
90 0.1
91 0.1
92 0.09
93 0.1
94 0.09
95 0.1
96 0.11
97 0.13
98 0.15
99 0.15
100 0.17
101 0.17
102 0.18
103 0.19