Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A448YRE9

Protein Details
Accession A0A448YRE9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MPSHKSFRTKQKLAKHQKQNRPLPQWIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito_nucl 13.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000077  Ribosomal_L39  
IPR023626  Ribosomal_L39e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00832  Ribosomal_L39  
Amino Acid Sequences MPSHKSFRTKQKLAKHQKQNRPLPQWIRLRTNNKIRYNAKRTHWRRTKLHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.87
4 0.88
5 0.9
6 0.89
7 0.87
8 0.83
9 0.8
10 0.74
11 0.72
12 0.7
13 0.64
14 0.61
15 0.6
16 0.6
17 0.6
18 0.66
19 0.67
20 0.64
21 0.68
22 0.69
23 0.71
24 0.73
25 0.72
26 0.71
27 0.72
28 0.73
29 0.76
30 0.78
31 0.77