Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YMC6

Protein Details
Accession A0A448YMC6   
Localization Confidence High
Confidence Score 17.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-43STVLNKGSSRIKKKIRDIKRLLKRGNLPHydrophilic
166-192EKSNPKFQKGLKRSKERRSYFKKLFSDHydrophilic
NLS Segment(s)
PositionSequence
24-39SRIKKKIRDIKRLLKR
70-97AKKIHSRYHKVRFFEKKKASRHYKGSSK
174-183KGLKRSKERR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.833, mito_nucl 11.666, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MARPGDSNMTPVVDLSTVLNKGSSRIKKKIRDIKRLLKRGNLPSDVVIANERALKTLDRELENVQLNQKAKKIHSRYHKVRFFEKKKASRHYKGSSKRLEELNKQREELVDATTKSEELEELDKQIKKQKKIVRQSEIDLAYVLNYPSTEKYISLYPNEGEELEVEKSNPKFQKGLKRSKERRSYFKKLFSDQLKEGKLRVGLEEGLREGERVHVEGQRAIDADERGEKKPEQKDEFFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.15
4 0.14
5 0.14
6 0.16
7 0.15
8 0.18
9 0.27
10 0.35
11 0.38
12 0.47
13 0.56
14 0.64
15 0.75
16 0.82
17 0.83
18 0.84
19 0.86
20 0.87
21 0.89
22 0.89
23 0.83
24 0.81
25 0.79
26 0.77
27 0.75
28 0.67
29 0.58
30 0.49
31 0.48
32 0.39
33 0.32
34 0.24
35 0.16
36 0.15
37 0.16
38 0.15
39 0.13
40 0.14
41 0.14
42 0.15
43 0.2
44 0.24
45 0.22
46 0.24
47 0.25
48 0.3
49 0.32
50 0.3
51 0.27
52 0.27
53 0.27
54 0.28
55 0.29
56 0.27
57 0.28
58 0.37
59 0.4
60 0.43
61 0.52
62 0.6
63 0.67
64 0.73
65 0.76
66 0.69
67 0.73
68 0.76
69 0.72
70 0.72
71 0.72
72 0.7
73 0.72
74 0.79
75 0.79
76 0.75
77 0.77
78 0.75
79 0.75
80 0.76
81 0.77
82 0.74
83 0.68
84 0.64
85 0.62
86 0.59
87 0.58
88 0.59
89 0.59
90 0.53
91 0.5
92 0.46
93 0.4
94 0.38
95 0.3
96 0.22
97 0.16
98 0.15
99 0.15
100 0.15
101 0.15
102 0.12
103 0.11
104 0.08
105 0.06
106 0.08
107 0.07
108 0.09
109 0.14
110 0.15
111 0.16
112 0.23
113 0.28
114 0.29
115 0.37
116 0.42
117 0.47
118 0.57
119 0.65
120 0.65
121 0.62
122 0.61
123 0.6
124 0.53
125 0.43
126 0.33
127 0.24
128 0.18
129 0.15
130 0.13
131 0.06
132 0.05
133 0.06
134 0.07
135 0.09
136 0.09
137 0.08
138 0.1
139 0.13
140 0.15
141 0.16
142 0.17
143 0.15
144 0.16
145 0.16
146 0.15
147 0.11
148 0.1
149 0.11
150 0.11
151 0.11
152 0.1
153 0.14
154 0.15
155 0.22
156 0.23
157 0.23
158 0.26
159 0.31
160 0.42
161 0.47
162 0.58
163 0.6
164 0.7
165 0.77
166 0.83
167 0.88
168 0.83
169 0.85
170 0.84
171 0.84
172 0.81
173 0.82
174 0.78
175 0.71
176 0.73
177 0.69
178 0.66
179 0.61
180 0.61
181 0.55
182 0.5
183 0.47
184 0.42
185 0.38
186 0.31
187 0.27
188 0.22
189 0.2
190 0.21
191 0.21
192 0.18
193 0.18
194 0.18
195 0.16
196 0.14
197 0.16
198 0.16
199 0.16
200 0.18
201 0.18
202 0.2
203 0.23
204 0.24
205 0.22
206 0.21
207 0.2
208 0.21
209 0.18
210 0.19
211 0.25
212 0.27
213 0.27
214 0.31
215 0.33
216 0.38
217 0.46
218 0.54
219 0.53