Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YHT5

Protein Details
Accession A0A448YHT5   
Localization Confidence Medium
Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
106-131ADVIKLRHKRLLRRNRKYGKIIKVHFBasic
NLS Segment(s)
PositionSequence
112-123RHKRLLRRNRKY
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR029184  Sas4_dom  
Gene Ontology GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF15460  SAS4  
Amino Acid Sequences MARLGRDVKLKARLSLEEQFRRILRFPLDNRELTRLASILPSITRITDPSDSSEIAVKYRLTVKELMRFILKFEQGKMRELELKRKKVKSEVDTDEEEGKDPINMADVIKLRHKRLLRRNRKYGKIIKVHFYQGITLVIDPVSKARIETKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.52
4 0.5
5 0.49
6 0.49
7 0.47
8 0.47
9 0.43
10 0.39
11 0.34
12 0.36
13 0.38
14 0.43
15 0.47
16 0.46
17 0.47
18 0.47
19 0.43
20 0.36
21 0.33
22 0.23
23 0.19
24 0.16
25 0.14
26 0.1
27 0.09
28 0.1
29 0.1
30 0.1
31 0.1
32 0.1
33 0.14
34 0.15
35 0.16
36 0.18
37 0.19
38 0.19
39 0.19
40 0.21
41 0.18
42 0.16
43 0.17
44 0.13
45 0.12
46 0.17
47 0.17
48 0.16
49 0.2
50 0.22
51 0.27
52 0.28
53 0.28
54 0.25
55 0.24
56 0.24
57 0.24
58 0.24
59 0.17
60 0.18
61 0.24
62 0.23
63 0.26
64 0.25
65 0.22
66 0.26
67 0.27
68 0.36
69 0.37
70 0.45
71 0.5
72 0.53
73 0.53
74 0.54
75 0.61
76 0.55
77 0.55
78 0.51
79 0.48
80 0.47
81 0.47
82 0.42
83 0.34
84 0.29
85 0.21
86 0.16
87 0.11
88 0.1
89 0.08
90 0.07
91 0.07
92 0.07
93 0.11
94 0.12
95 0.15
96 0.22
97 0.26
98 0.26
99 0.33
100 0.38
101 0.43
102 0.53
103 0.62
104 0.66
105 0.72
106 0.82
107 0.84
108 0.88
109 0.87
110 0.86
111 0.84
112 0.83
113 0.77
114 0.73
115 0.68
116 0.64
117 0.57
118 0.49
119 0.4
120 0.32
121 0.29
122 0.23
123 0.19
124 0.15
125 0.13
126 0.12
127 0.11
128 0.11
129 0.11
130 0.1
131 0.11