Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YF98

Protein Details
Accession A0A448YF98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MAPRLTPKIVKKNTKTFKRHQSDRFKRVAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5mito_nucl 11.5, mito 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAPRLTPKIVKKNTKTFKRHQSDRFKRVAENWRLQKGIDSRVRRRFRGVIYAPKIGYGSNKKTKFLDPSGKKVVTVSNLKELEALLMNNKLYAAEIAHSVSAKNRASILSRAKAIGVKVTNPKGRLTLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.85
3 0.84
4 0.85
5 0.85
6 0.86
7 0.85
8 0.86
9 0.87
10 0.87
11 0.84
12 0.76
13 0.68
14 0.67
15 0.68
16 0.65
17 0.64
18 0.63
19 0.6
20 0.58
21 0.55
22 0.52
23 0.46
24 0.46
25 0.44
26 0.45
27 0.49
28 0.59
29 0.64
30 0.6
31 0.61
32 0.57
33 0.52
34 0.54
35 0.5
36 0.5
37 0.49
38 0.51
39 0.45
40 0.41
41 0.38
42 0.28
43 0.29
44 0.25
45 0.28
46 0.33
47 0.35
48 0.36
49 0.38
50 0.4
51 0.4
52 0.39
53 0.42
54 0.37
55 0.42
56 0.48
57 0.46
58 0.43
59 0.38
60 0.34
61 0.29
62 0.3
63 0.25
64 0.26
65 0.26
66 0.26
67 0.26
68 0.24
69 0.2
70 0.16
71 0.15
72 0.08
73 0.09
74 0.09
75 0.09
76 0.09
77 0.08
78 0.07
79 0.07
80 0.06
81 0.06
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.1
88 0.17
89 0.17
90 0.17
91 0.17
92 0.18
93 0.22
94 0.29
95 0.34
96 0.32
97 0.33
98 0.32
99 0.33
100 0.33
101 0.31
102 0.31
103 0.26
104 0.27
105 0.34
106 0.42
107 0.46
108 0.45
109 0.46
110 0.43