Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A448YJJ1

Protein Details
Accession A0A448YJJ1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-109REGKIQKTKTEKKHSGHQEPAYBasic
NLS Segment(s)
Subcellular Location(s) cyto 19.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036786  Ribosome_mat_SBDS_N_sf  
IPR019783  SDO1/SBDS_N  
Pfam View protein in Pfam  
PF01172  SBDS  
Amino Acid Sequences MTGATKVFYRGKKVDFCLFIDSEHAYHKWLDGDKSVPLSDVLGSYEIYVNTTGTGAEGELEAASKQTLAEEFGSFDSVEDDIIPKILREGKIQKTKTEKKHSGHQEPAYKTVG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.5
3 0.49
4 0.47
5 0.41
6 0.36
7 0.31
8 0.27
9 0.21
10 0.21
11 0.18
12 0.15
13 0.14
14 0.15
15 0.16
16 0.17
17 0.18
18 0.17
19 0.18
20 0.18
21 0.2
22 0.19
23 0.16
24 0.14
25 0.13
26 0.11
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.08
33 0.07
34 0.08
35 0.08
36 0.07
37 0.06
38 0.06
39 0.05
40 0.04
41 0.04
42 0.04
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.05
56 0.07
57 0.07
58 0.08
59 0.08
60 0.1
61 0.09
62 0.09
63 0.08
64 0.07
65 0.07
66 0.06
67 0.07
68 0.06
69 0.07
70 0.07
71 0.06
72 0.09
73 0.14
74 0.15
75 0.21
76 0.28
77 0.37
78 0.47
79 0.49
80 0.54
81 0.6
82 0.68
83 0.72
84 0.75
85 0.74
86 0.7
87 0.78
88 0.81
89 0.8
90 0.8
91 0.78
92 0.76
93 0.71