Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YLP9

Protein Details
Accession A0A448YLP9   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
16-38RIADAFRRHRLRQQRRRMTEEDNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR016901  APC10/Doc1  
IPR004939  APC_su10/DOC_dom  
IPR008979  Galactose-bd-like_sf  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF03256  ANAPC10  
PROSITE View protein in PROSITE  
PS51284  DOC  
CDD cd08366  APC10  
Amino Acid Sequences MPNFGSQSDTPDTPGRIADAFRRHRLRQQRRRMTEEDNDGDVLPEGADLGDDDGNDNYNDDAHTHSSSSSHHGTPSHDTGSNGDSFAGGFDDEAAFSAGIRSMEGLGLVDIGNLATWTASSSKAGFGMKELREDSPFSYWQSDGQQPHFITIHFTKKVAIERICLYLNYEADESYTPSKMLILSGSGDHDLVEVASREMTEPMGWQIIQFKGIRYDNSLRCHLIKICLLSNHQNGKDSHVRCLKVMSRQKEGVSEREDEVGFTEVGFTSVKLRSESGIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.21
4 0.22
5 0.26
6 0.32
7 0.37
8 0.46
9 0.53
10 0.54
11 0.61
12 0.71
13 0.75
14 0.76
15 0.8
16 0.82
17 0.82
18 0.86
19 0.83
20 0.79
21 0.76
22 0.74
23 0.66
24 0.57
25 0.5
26 0.42
27 0.37
28 0.3
29 0.21
30 0.12
31 0.08
32 0.06
33 0.04
34 0.04
35 0.04
36 0.06
37 0.06
38 0.06
39 0.07
40 0.07
41 0.09
42 0.09
43 0.09
44 0.07
45 0.08
46 0.08
47 0.08
48 0.1
49 0.12
50 0.13
51 0.13
52 0.13
53 0.14
54 0.15
55 0.19
56 0.2
57 0.18
58 0.19
59 0.2
60 0.23
61 0.28
62 0.3
63 0.28
64 0.26
65 0.25
66 0.25
67 0.26
68 0.24
69 0.18
70 0.14
71 0.11
72 0.09
73 0.09
74 0.08
75 0.05
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.06
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.02
103 0.02
104 0.03
105 0.04
106 0.05
107 0.06
108 0.06
109 0.07
110 0.09
111 0.09
112 0.09
113 0.1
114 0.16
115 0.16
116 0.18
117 0.19
118 0.18
119 0.19
120 0.2
121 0.19
122 0.16
123 0.16
124 0.15
125 0.15
126 0.14
127 0.14
128 0.16
129 0.2
130 0.19
131 0.2
132 0.24
133 0.22
134 0.24
135 0.23
136 0.2
137 0.19
138 0.21
139 0.25
140 0.2
141 0.21
142 0.2
143 0.22
144 0.27
145 0.28
146 0.26
147 0.22
148 0.23
149 0.25
150 0.25
151 0.22
152 0.2
153 0.17
154 0.16
155 0.15
156 0.13
157 0.1
158 0.11
159 0.11
160 0.12
161 0.11
162 0.11
163 0.09
164 0.09
165 0.1
166 0.09
167 0.09
168 0.07
169 0.06
170 0.07
171 0.07
172 0.08
173 0.08
174 0.08
175 0.08
176 0.07
177 0.06
178 0.05
179 0.06
180 0.05
181 0.05
182 0.05
183 0.05
184 0.06
185 0.06
186 0.07
187 0.06
188 0.07
189 0.08
190 0.09
191 0.09
192 0.09
193 0.12
194 0.12
195 0.16
196 0.16
197 0.15
198 0.21
199 0.23
200 0.24
201 0.27
202 0.35
203 0.37
204 0.42
205 0.44
206 0.4
207 0.39
208 0.42
209 0.37
210 0.33
211 0.31
212 0.29
213 0.29
214 0.3
215 0.33
216 0.36
217 0.42
218 0.45
219 0.43
220 0.45
221 0.42
222 0.46
223 0.51
224 0.45
225 0.47
226 0.46
227 0.46
228 0.41
229 0.48
230 0.45
231 0.47
232 0.54
233 0.51
234 0.52
235 0.54
236 0.55
237 0.56
238 0.55
239 0.52
240 0.47
241 0.44
242 0.38
243 0.38
244 0.36
245 0.28
246 0.26
247 0.21
248 0.17
249 0.14
250 0.14
251 0.1
252 0.11
253 0.11
254 0.1
255 0.12
256 0.15
257 0.18
258 0.18
259 0.19