Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YT91

Protein Details
Accession A0A448YT91   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
60-89EDLKKSDYFKYKRRQVKKRNVEQCKMNNFMHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, mito_nucl 13.333, cyto_mito 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MNRAVIRLFSSSTRALQSSCKEGTPITLEIYKAGKPVVAKKDEEYPPWLWTLLDKEKQMEDLKKSDYFKYKRRQVKKRNVEQCKMNNFMAKMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.26
4 0.27
5 0.29
6 0.28
7 0.26
8 0.25
9 0.24
10 0.25
11 0.23
12 0.21
13 0.17
14 0.18
15 0.17
16 0.18
17 0.2
18 0.18
19 0.14
20 0.13
21 0.12
22 0.12
23 0.19
24 0.24
25 0.25
26 0.26
27 0.26
28 0.35
29 0.35
30 0.35
31 0.33
32 0.27
33 0.25
34 0.25
35 0.23
36 0.15
37 0.14
38 0.18
39 0.2
40 0.22
41 0.21
42 0.22
43 0.22
44 0.26
45 0.3
46 0.28
47 0.26
48 0.26
49 0.29
50 0.32
51 0.34
52 0.36
53 0.41
54 0.43
55 0.49
56 0.56
57 0.62
58 0.67
59 0.76
60 0.81
61 0.83
62 0.88
63 0.9
64 0.91
65 0.92
66 0.92
67 0.88
68 0.87
69 0.85
70 0.82
71 0.76
72 0.68
73 0.63