Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A448YIJ8

Protein Details
Accession A0A448YIJ8    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MPSIHNRASRKHKKLIGRRSKVRIQRNVHydrophilic
NLS Segment(s)
PositionSequence
8-22ASRKHKKLIGRRSKV
Subcellular Location(s) nucl 17.5, mito_nucl 14, mito 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences MPSIHNRASRKHKKLIGRRSKVRIQRNVDLLMYLNYLRFVNALVVKANELCDKDSSSEILPKHLEEAKREVMKRFRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.83
4 0.83
5 0.84
6 0.82
7 0.84
8 0.82
9 0.82
10 0.8
11 0.76
12 0.72
13 0.67
14 0.62
15 0.53
16 0.44
17 0.35
18 0.26
19 0.2
20 0.14
21 0.09
22 0.08
23 0.08
24 0.07
25 0.06
26 0.06
27 0.07
28 0.08
29 0.09
30 0.08
31 0.09
32 0.09
33 0.1
34 0.11
35 0.11
36 0.1
37 0.11
38 0.12
39 0.13
40 0.15
41 0.15
42 0.16
43 0.15
44 0.19
45 0.18
46 0.21
47 0.21
48 0.19
49 0.23
50 0.26
51 0.27
52 0.26
53 0.33
54 0.37
55 0.44
56 0.46
57 0.49