Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YSZ6

Protein Details
Accession A0A448YSZ6   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
274-294RNEFWNKETIRRRRAIQRKQEHydrophilic
NLS Segment(s)
PositionSequence
41-66GVRHRRRSSEKSTPRARGSSRSRTRA
Subcellular Location(s) plas 12, nucl 9.5, cyto_nucl 6, mito 2, cyto 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005605  Spo7  
Gene Ontology GO:0016020  C:membrane  
GO:0019888  F:protein phosphatase regulator activity  
Pfam View protein in Pfam  
PF03907  Spo7  
Amino Acid Sequences MLEDKTASVQNSPIRSSPLSRRIHDYETDSPIRGTPPPEGGVRHRRRSSEKSTPRARGSSRSRTRAKEEVEISPTAQIYKNLLILEEALRQQNAQQSKLKAKYTIFLVSMLFVLLLTFYVSFVDGGGGGGGGPSYWRFSCQVVGSIDFLTLVLYYLSGEYNRTITRPRKFLTYTNKGIRRMNIRLVKVRVKRVDRLLDMVKMCLLFPTIVLKTQCQYVLVVFPRFGLVIKLRNWLLEFEAKLQSSSGGGVDGVKVILNPRVFSTGTREQWELYRNEFWNKETIRRRRAIQRKQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.38
4 0.43
5 0.47
6 0.5
7 0.5
8 0.56
9 0.56
10 0.58
11 0.56
12 0.54
13 0.5
14 0.51
15 0.51
16 0.44
17 0.39
18 0.36
19 0.34
20 0.3
21 0.26
22 0.22
23 0.23
24 0.25
25 0.26
26 0.29
27 0.35
28 0.44
29 0.5
30 0.57
31 0.57
32 0.61
33 0.67
34 0.71
35 0.73
36 0.73
37 0.73
38 0.74
39 0.78
40 0.79
41 0.76
42 0.75
43 0.69
44 0.67
45 0.66
46 0.68
47 0.68
48 0.69
49 0.7
50 0.69
51 0.73
52 0.7
53 0.65
54 0.62
55 0.56
56 0.52
57 0.49
58 0.44
59 0.38
60 0.32
61 0.28
62 0.22
63 0.2
64 0.15
65 0.15
66 0.15
67 0.17
68 0.15
69 0.15
70 0.13
71 0.13
72 0.14
73 0.14
74 0.14
75 0.13
76 0.13
77 0.12
78 0.14
79 0.18
80 0.19
81 0.2
82 0.24
83 0.27
84 0.36
85 0.41
86 0.41
87 0.4
88 0.38
89 0.37
90 0.35
91 0.34
92 0.27
93 0.22
94 0.2
95 0.17
96 0.16
97 0.13
98 0.09
99 0.05
100 0.04
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.04
108 0.04
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.03
115 0.03
116 0.03
117 0.02
118 0.02
119 0.02
120 0.03
121 0.05
122 0.05
123 0.07
124 0.08
125 0.09
126 0.12
127 0.12
128 0.16
129 0.15
130 0.16
131 0.15
132 0.14
133 0.13
134 0.11
135 0.1
136 0.06
137 0.05
138 0.04
139 0.03
140 0.03
141 0.03
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.07
148 0.08
149 0.09
150 0.15
151 0.22
152 0.27
153 0.31
154 0.32
155 0.36
156 0.38
157 0.45
158 0.48
159 0.49
160 0.52
161 0.56
162 0.6
163 0.58
164 0.57
165 0.55
166 0.52
167 0.48
168 0.49
169 0.46
170 0.44
171 0.48
172 0.5
173 0.54
174 0.53
175 0.57
176 0.56
177 0.54
178 0.56
179 0.56
180 0.57
181 0.5
182 0.5
183 0.44
184 0.41
185 0.37
186 0.32
187 0.26
188 0.2
189 0.18
190 0.14
191 0.12
192 0.07
193 0.07
194 0.12
195 0.11
196 0.15
197 0.17
198 0.17
199 0.17
200 0.2
201 0.2
202 0.15
203 0.15
204 0.12
205 0.18
206 0.2
207 0.21
208 0.18
209 0.18
210 0.18
211 0.17
212 0.17
213 0.14
214 0.14
215 0.18
216 0.2
217 0.25
218 0.25
219 0.26
220 0.27
221 0.24
222 0.24
223 0.23
224 0.23
225 0.22
226 0.26
227 0.25
228 0.24
229 0.23
230 0.2
231 0.15
232 0.15
233 0.11
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.06
241 0.06
242 0.08
243 0.13
244 0.14
245 0.14
246 0.15
247 0.19
248 0.19
249 0.2
250 0.27
251 0.31
252 0.34
253 0.38
254 0.37
255 0.35
256 0.39
257 0.44
258 0.39
259 0.35
260 0.38
261 0.37
262 0.43
263 0.44
264 0.41
265 0.44
266 0.44
267 0.49
268 0.52
269 0.59
270 0.61
271 0.65
272 0.7
273 0.72
274 0.8