Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YH80

Protein Details
Accession A0A448YH80   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-37DNASPSPQPQQPNKPKKKRFEVKKWTAVAFHydrophilic
NLS Segment(s)
PositionSequence
21-26KPKKKR
Subcellular Location(s) nucl 22, mito_nucl 12.833, cyto_nucl 12.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
IPR024766  Znf_RING_H2  
Gene Ontology GO:0008270  F:zinc ion binding  
GO:0016567  P:protein ubiquitination  
Pfam View protein in Pfam  
PF12678  zf-rbx1  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MSEQMDVDNASPSPQPQQPNKPKKKRFEVKKWTAVAFWSWDQSNETCAICRNHLMEPCIECSGSGKDRSNCPRAVGVCNHSFHLHCIDTWIKTRNSCPLDSSEWTLKEVLQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.28
3 0.34
4 0.45
5 0.55
6 0.65
7 0.75
8 0.81
9 0.86
10 0.88
11 0.91
12 0.91
13 0.9
14 0.9
15 0.9
16 0.89
17 0.89
18 0.82
19 0.72
20 0.62
21 0.52
22 0.42
23 0.35
24 0.26
25 0.2
26 0.16
27 0.16
28 0.17
29 0.16
30 0.16
31 0.14
32 0.13
33 0.11
34 0.14
35 0.15
36 0.14
37 0.15
38 0.15
39 0.17
40 0.18
41 0.19
42 0.17
43 0.17
44 0.18
45 0.17
46 0.15
47 0.12
48 0.12
49 0.15
50 0.15
51 0.18
52 0.21
53 0.23
54 0.3
55 0.37
56 0.4
57 0.37
58 0.36
59 0.37
60 0.34
61 0.37
62 0.33
63 0.33
64 0.33
65 0.33
66 0.33
67 0.3
68 0.28
69 0.25
70 0.26
71 0.21
72 0.16
73 0.2
74 0.21
75 0.22
76 0.26
77 0.3
78 0.28
79 0.3
80 0.33
81 0.38
82 0.39
83 0.38
84 0.36
85 0.36
86 0.39
87 0.39
88 0.43
89 0.41
90 0.38
91 0.38
92 0.36