Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YTG6

Protein Details
Accession A0A448YTG6    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
78-135ITIRTSKKWVLPPRPKPGRKPSVIKREKKRRKDVPKAPKSAKTQKAPKVPKVPKVPKSBasic
NLS Segment(s)
PositionSequence
84-144KKWVLPPRPKPGRKPSVIKREKKRRKDVPKAPKSAKTQKAPKVPKVPKVPKSAKSTKPVKP
Subcellular Location(s) nucl 20, cyto 3.5, cyto_mito 3, mito 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018287  Hap4_TF_heteromerisation  
Gene Ontology GO:0005634  C:nucleus  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF10297  Hap4_Hap_bind  
Amino Acid Sequences MATDTKSSLPKIAPAPANLHVQIAPAMAISNRLSLSLDRCNSETPNHIHNKTIHSPSCLSPIPLAKSLSLSAIPDQPITIRTSKKWVLPPRPKPGRKPSVIKREKKRRKDVPKAPKSAKTQKAPKVPKVPKVPKSAKSTKPVKPSKDEQSQLALPSPPSTSPYIELDSSIIDNPIKQEILRINEENYFLKLEVIRLVSDLKSMRKKAHTGKHHHQHQHVHHSDSVLSPISPISQPPSRKRLHDEDINDLIVSLVDLNPTDQLMDTSKSMVTTSPLVSPNSNHNVSSPIQVPASKSNERLLGKNRALLPSESTNLLQSDEFLNLDGQEPTAFLLQGSPTVLSEDDDLTSTISTTPSTMLTSIKTNDTLDSLSGTTIASNNSPTFKLLDIPEIDLGTKIGKEAFSIFNGPASLVDDAIFGSTGERAEGDVDNEENGNENNSNSDNSNDFYEFDGTDDVEMEFENFINGNDLEMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.41
3 0.41
4 0.46
5 0.4
6 0.38
7 0.3
8 0.27
9 0.25
10 0.2
11 0.16
12 0.1
13 0.1
14 0.08
15 0.11
16 0.11
17 0.13
18 0.13
19 0.13
20 0.15
21 0.16
22 0.21
23 0.27
24 0.29
25 0.29
26 0.3
27 0.33
28 0.34
29 0.35
30 0.37
31 0.33
32 0.4
33 0.46
34 0.45
35 0.47
36 0.49
37 0.54
38 0.54
39 0.58
40 0.51
41 0.48
42 0.5
43 0.46
44 0.49
45 0.42
46 0.36
47 0.32
48 0.35
49 0.35
50 0.36
51 0.35
52 0.29
53 0.3
54 0.29
55 0.27
56 0.21
57 0.18
58 0.17
59 0.2
60 0.2
61 0.18
62 0.18
63 0.16
64 0.17
65 0.2
66 0.23
67 0.23
68 0.24
69 0.32
70 0.35
71 0.41
72 0.49
73 0.55
74 0.6
75 0.68
76 0.75
77 0.78
78 0.85
79 0.86
80 0.86
81 0.87
82 0.86
83 0.83
84 0.83
85 0.82
86 0.83
87 0.86
88 0.86
89 0.86
90 0.87
91 0.9
92 0.91
93 0.91
94 0.91
95 0.92
96 0.93
97 0.93
98 0.93
99 0.93
100 0.92
101 0.87
102 0.84
103 0.82
104 0.82
105 0.79
106 0.77
107 0.77
108 0.76
109 0.8
110 0.8
111 0.79
112 0.8
113 0.78
114 0.77
115 0.79
116 0.8
117 0.77
118 0.8
119 0.79
120 0.76
121 0.78
122 0.79
123 0.75
124 0.75
125 0.76
126 0.72
127 0.75
128 0.75
129 0.72
130 0.69
131 0.69
132 0.69
133 0.69
134 0.64
135 0.56
136 0.53
137 0.49
138 0.43
139 0.38
140 0.3
141 0.21
142 0.21
143 0.19
144 0.14
145 0.15
146 0.16
147 0.15
148 0.16
149 0.18
150 0.19
151 0.18
152 0.17
153 0.15
154 0.14
155 0.13
156 0.11
157 0.1
158 0.08
159 0.08
160 0.09
161 0.1
162 0.09
163 0.08
164 0.12
165 0.14
166 0.19
167 0.22
168 0.22
169 0.22
170 0.24
171 0.26
172 0.23
173 0.21
174 0.17
175 0.14
176 0.14
177 0.12
178 0.11
179 0.11
180 0.11
181 0.1
182 0.1
183 0.11
184 0.1
185 0.12
186 0.14
187 0.17
188 0.22
189 0.24
190 0.28
191 0.3
192 0.36
193 0.42
194 0.5
195 0.53
196 0.57
197 0.65
198 0.7
199 0.76
200 0.75
201 0.72
202 0.71
203 0.68
204 0.69
205 0.62
206 0.54
207 0.46
208 0.41
209 0.36
210 0.28
211 0.24
212 0.13
213 0.1
214 0.08
215 0.07
216 0.08
217 0.07
218 0.07
219 0.1
220 0.14
221 0.2
222 0.24
223 0.32
224 0.33
225 0.36
226 0.41
227 0.44
228 0.45
229 0.46
230 0.43
231 0.42
232 0.41
233 0.39
234 0.33
235 0.26
236 0.2
237 0.14
238 0.11
239 0.05
240 0.03
241 0.03
242 0.03
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.06
250 0.08
251 0.08
252 0.09
253 0.09
254 0.09
255 0.09
256 0.09
257 0.08
258 0.09
259 0.1
260 0.13
261 0.15
262 0.16
263 0.16
264 0.17
265 0.22
266 0.26
267 0.26
268 0.22
269 0.2
270 0.23
271 0.23
272 0.25
273 0.2
274 0.16
275 0.16
276 0.16
277 0.18
278 0.21
279 0.26
280 0.25
281 0.25
282 0.26
283 0.32
284 0.33
285 0.35
286 0.35
287 0.38
288 0.37
289 0.4
290 0.4
291 0.36
292 0.36
293 0.33
294 0.3
295 0.24
296 0.25
297 0.21
298 0.19
299 0.18
300 0.17
301 0.17
302 0.13
303 0.1
304 0.1
305 0.1
306 0.09
307 0.09
308 0.09
309 0.08
310 0.09
311 0.08
312 0.07
313 0.07
314 0.07
315 0.07
316 0.07
317 0.07
318 0.06
319 0.07
320 0.07
321 0.07
322 0.08
323 0.08
324 0.07
325 0.08
326 0.08
327 0.08
328 0.09
329 0.09
330 0.09
331 0.09
332 0.09
333 0.09
334 0.08
335 0.08
336 0.07
337 0.07
338 0.07
339 0.07
340 0.08
341 0.08
342 0.09
343 0.1
344 0.1
345 0.11
346 0.15
347 0.16
348 0.17
349 0.18
350 0.18
351 0.18
352 0.18
353 0.17
354 0.14
355 0.14
356 0.12
357 0.1
358 0.1
359 0.09
360 0.08
361 0.09
362 0.1
363 0.09
364 0.11
365 0.13
366 0.15
367 0.15
368 0.16
369 0.16
370 0.16
371 0.19
372 0.17
373 0.21
374 0.2
375 0.22
376 0.22
377 0.21
378 0.21
379 0.17
380 0.16
381 0.12
382 0.1
383 0.09
384 0.09
385 0.09
386 0.09
387 0.13
388 0.15
389 0.16
390 0.18
391 0.18
392 0.18
393 0.18
394 0.17
395 0.14
396 0.14
397 0.12
398 0.1
399 0.1
400 0.09
401 0.09
402 0.09
403 0.08
404 0.06
405 0.06
406 0.07
407 0.07
408 0.07
409 0.07
410 0.07
411 0.09
412 0.1
413 0.11
414 0.12
415 0.13
416 0.13
417 0.14
418 0.13
419 0.13
420 0.12
421 0.14
422 0.13
423 0.12
424 0.14
425 0.16
426 0.18
427 0.17
428 0.2
429 0.18
430 0.19
431 0.23
432 0.21
433 0.21
434 0.21
435 0.22
436 0.19
437 0.19
438 0.19
439 0.15
440 0.14
441 0.14
442 0.11
443 0.09
444 0.09
445 0.09
446 0.08
447 0.08
448 0.08
449 0.08
450 0.08
451 0.12
452 0.11