FuNGI

A0A448YTG6

Protein Details

Accession

A0A448YTG6

Localization Confidence

High

Confidence Score

15.1

NoLS Segment(s)

Position	Sequence	Protein Nature
78-135	ITIRTSKKWVLPPRPKPGRKPSVIKREKKRRKDVPKAPKSAKTQKAPKVPKVPKVPKS	Basic

NLS Segment(s)

Position	Sequence
84-144	KKWVLPPRPKPGRKPSVIKREKKRRKDVPKAPKSAKTQKAPKVPKVPKVPKSAKSTKPVKP

Subcellular Location(s)

nucl 20, cyto 3.5, cyto_mito 3, mito 1.5

Family & Domain DBs

InterPro	View protein in InterPro IPR018287 Hap4_TF_heteromerisation
Gene Ontology	GO:0005634 C:nucleus GO:0006355 P:regulation of DNA-templated transcription
Pfam	View protein in Pfam PF10297 Hap4_Hap_bind

Amino Acid Sequences

MATDTKSSLPKIAPAPANLHVQIAPAMAISNRLSLSLDRCNSETPNHIHNKTIHSPSCLSPIPLAKSLSLSAIPDQPITIRTSKKWVLPPRPKPGRKPSVIKREKKRRKDVPKAPKSAKTQKAPKVPKVPKVPKSAKSTKPVKPSKDEQSQLALPSPPSTSPYIELDSSIIDNPIKQEILRINEENYFLKLEVIRLVSDLKSMRKKAHTGKHHHQHQHVHHSDSVLSPISPISQPPSRKRLHDEDINDLIVSLVDLNPTDQLMDTSKSMVTTSPLVSPNSNHNVSSPIQVPASKSNERLLGKNRALLPSESTNLLQSDEFLNLDGQEPTAFLLQGSPTVLSEDDDLTSTISTTPSTMLTSIKTNDTLDSLSGTTIASNNSPTFKLLDIPEIDLGTKIGKEAFSIFNGPASLVDDAIFGSTGERAEGDVDNEENGNENNSNSDNSNDFYEFDGTDDVEMEFENFINGNDLEMT

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.38
2	0.41
3	0.41
4	0.46
5	0.4
6	0.38
7	0.3
8	0.27
9	0.25
10	0.2
11	0.16
12	0.1
13	0.1
14	0.08
15	0.11
16	0.11
17	0.13
18	0.13
19	0.13
20	0.15
21	0.16
22	0.21
23	0.27
24	0.29
25	0.29
26	0.3
27	0.33
28	0.34
29	0.35
30	0.37
31	0.33
32	0.4
33	0.46
34	0.45
35	0.47
36	0.49
37	0.54
38	0.54
39	0.58
40	0.51
41	0.48
42	0.5
43	0.46
44	0.49
45	0.42
46	0.36
47	0.32
48	0.35
49	0.35
50	0.36
51	0.35
52	0.29
53	0.3
54	0.29
55	0.27
56	0.21
57	0.18
58	0.17
59	0.2
60	0.2
61	0.18
62	0.18
63	0.16
64	0.17
65	0.2
66	0.23
67	0.23
68	0.24
69	0.32
70	0.35
71	0.41
72	0.49
73	0.55
74	0.6
75	0.68
76	0.75
77	0.78
78	0.85
79	0.86
80	0.86
81	0.87
82	0.86
83	0.83
84	0.83
85	0.82
86	0.83
87	0.86
88	0.86
89	0.86
90	0.87
91	0.9
92	0.91
93	0.91
94	0.91
95	0.92
96	0.93
97	0.93
98	0.93
99	0.93
100	0.92
101	0.87
102	0.84
103	0.82
104	0.82
105	0.79
106	0.77
107	0.77
108	0.76
109	0.8
110	0.8
111	0.79
112	0.8
113	0.78
114	0.77
115	0.79
116	0.8
117	0.77
118	0.8
119	0.79
120	0.76
121	0.78
122	0.79
123	0.75
124	0.75
125	0.76
126	0.72
127	0.75
128	0.75
129	0.72
130	0.69
131	0.69
132	0.69
133	0.69
134	0.64
135	0.56
136	0.53
137	0.49
138	0.43
139	0.38
140	0.3
141	0.21
142	0.21
143	0.19
144	0.14
145	0.15
146	0.16
147	0.15
148	0.16
149	0.18
150	0.19
151	0.18
152	0.17
153	0.15
154	0.14
155	0.13
156	0.11
157	0.1
158	0.08
159	0.08
160	0.09
161	0.1
162	0.09
163	0.08
164	0.12
165	0.14
166	0.19
167	0.22
168	0.22
169	0.22
170	0.24
171	0.26
172	0.23
173	0.21
174	0.17
175	0.14
176	0.14
177	0.12
178	0.11
179	0.11
180	0.11
181	0.1
182	0.1
183	0.11
184	0.1
185	0.12
186	0.14
187	0.17
188	0.22
189	0.24
190	0.28
191	0.3
192	0.36
193	0.42
194	0.5
195	0.53
196	0.57
197	0.65
198	0.7
199	0.76
200	0.75
201	0.72
202	0.71
203	0.68
204	0.69
205	0.62
206	0.54
207	0.46
208	0.41
209	0.36
210	0.28
211	0.24
212	0.13
213	0.1
214	0.08
215	0.07
216	0.08
217	0.07
218	0.07
219	0.1
220	0.14
221	0.2
222	0.24
223	0.32
224	0.33
225	0.36
226	0.41
227	0.44
228	0.45
229	0.46
230	0.43
231	0.42
232	0.41
233	0.39
234	0.33
235	0.26
236	0.2
237	0.14
238	0.11
239	0.05
240	0.03
241	0.03
242	0.03
243	0.04
244	0.04
245	0.04
246	0.04
247	0.04
248	0.05
249	0.06
250	0.08
251	0.08
252	0.09
253	0.09
254	0.09
255	0.09
256	0.09
257	0.08
258	0.09
259	0.1
260	0.13
261	0.15
262	0.16
263	0.16
264	0.17
265	0.22
266	0.26
267	0.26
268	0.22
269	0.2
270	0.23
271	0.23
272	0.25
273	0.2
274	0.16
275	0.16
276	0.16
277	0.18
278	0.21
279	0.26
280	0.25
281	0.25
282	0.26
283	0.32
284	0.33
285	0.35
286	0.35
287	0.38
288	0.37
289	0.4
290	0.4
291	0.36
292	0.36
293	0.33
294	0.3
295	0.24
296	0.25
297	0.21
298	0.19
299	0.18
300	0.17
301	0.17
302	0.13
303	0.1
304	0.1
305	0.1
306	0.09
307	0.09
308	0.09
309	0.08
310	0.09
311	0.08
312	0.07
313	0.07
314	0.07
315	0.07
316	0.07
317	0.07
318	0.06
319	0.07
320	0.07
321	0.07
322	0.08
323	0.08
324	0.07
325	0.08
326	0.08
327	0.08
328	0.09
329	0.09
330	0.09
331	0.09
332	0.09
333	0.09
334	0.08
335	0.08
336	0.07
337	0.07
338	0.07
339	0.07
340	0.08
341	0.08
342	0.09
343	0.1
344	0.1
345	0.11
346	0.15
347	0.16
348	0.17
349	0.18
350	0.18
351	0.18
352	0.18
353	0.17
354	0.14
355	0.14
356	0.12
357	0.1
358	0.1
359	0.09
360	0.08
361	0.09
362	0.1
363	0.09
364	0.11
365	0.13
366	0.15
367	0.15
368	0.16
369	0.16
370	0.16
371	0.19
372	0.17
373	0.21
374	0.2
375	0.22
376	0.22
377	0.21
378	0.21
379	0.17
380	0.16
381	0.12
382	0.1
383	0.09
384	0.09
385	0.09
386	0.09
387	0.13
388	0.15
389	0.16
390	0.18
391	0.18
392	0.18
393	0.18
394	0.17
395	0.14
396	0.14
397	0.12
398	0.1
399	0.1
400	0.09
401	0.09
402	0.09
403	0.08
404	0.06
405	0.06
406	0.07
407	0.07
408	0.07
409	0.07
410	0.07
411	0.09
412	0.1
413	0.11
414	0.12
415	0.13
416	0.13
417	0.14
418	0.13
419	0.13
420	0.12
421	0.14
422	0.13
423	0.12
424	0.14
425	0.16
426	0.18
427	0.17
428	0.2
429	0.18
430	0.19
431	0.23
432	0.21
433	0.21
434	0.21
435	0.22
436	0.19
437	0.19
438	0.19
439	0.15
440	0.14
441	0.14
442	0.11
443	0.09
444	0.09
445	0.09
446	0.08
447	0.08
448	0.08
449	0.08
450	0.08
451	0.12
452	0.11

A0A448YTG6

3D AlphaFold-predicted Structure Viewer