Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A448YK56

Protein Details
Accession A0A448YK56    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
30-49FYKRAWYKWKSLKNVPFRKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto 4, mito 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007763  NDUFA12  
Gene Ontology GO:0016020  C:membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Pfam View protein in Pfam  
PF05071  NDUFA12  
Amino Acid Sequences MSTILSNNDFFPPQTLLAIDMDRVKLLVPFYKRAWYKWKSLKNVPFRKQFFAGYDLKGNTYWEFFPQGTTNIKPRRIWHPYRSQSFLFDYYDKLPIQWLQWLRYSRWKAPTVQELVDDEKRLQRLQKLVKLKGEELEYKKSVADNEIVQNMYKELQKQGHIESGKDDSKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.16
5 0.16
6 0.15
7 0.14
8 0.14
9 0.13
10 0.13
11 0.11
12 0.11
13 0.13
14 0.17
15 0.19
16 0.23
17 0.25
18 0.33
19 0.35
20 0.37
21 0.45
22 0.43
23 0.49
24 0.55
25 0.61
26 0.61
27 0.69
28 0.74
29 0.75
30 0.82
31 0.8
32 0.8
33 0.75
34 0.72
35 0.65
36 0.58
37 0.49
38 0.44
39 0.39
40 0.31
41 0.32
42 0.27
43 0.26
44 0.24
45 0.23
46 0.18
47 0.16
48 0.15
49 0.12
50 0.14
51 0.13
52 0.14
53 0.14
54 0.16
55 0.17
56 0.18
57 0.25
58 0.28
59 0.32
60 0.33
61 0.35
62 0.41
63 0.47
64 0.51
65 0.51
66 0.56
67 0.6
68 0.62
69 0.63
70 0.54
71 0.48
72 0.43
73 0.38
74 0.29
75 0.22
76 0.19
77 0.16
78 0.19
79 0.16
80 0.14
81 0.13
82 0.12
83 0.13
84 0.16
85 0.17
86 0.16
87 0.21
88 0.24
89 0.25
90 0.33
91 0.38
92 0.38
93 0.42
94 0.43
95 0.41
96 0.44
97 0.49
98 0.43
99 0.39
100 0.35
101 0.3
102 0.32
103 0.31
104 0.27
105 0.21
106 0.21
107 0.22
108 0.22
109 0.23
110 0.23
111 0.3
112 0.37
113 0.43
114 0.48
115 0.52
116 0.55
117 0.56
118 0.53
119 0.48
120 0.44
121 0.44
122 0.4
123 0.42
124 0.38
125 0.35
126 0.34
127 0.32
128 0.28
129 0.23
130 0.22
131 0.18
132 0.21
133 0.24
134 0.24
135 0.23
136 0.22
137 0.2
138 0.2
139 0.19
140 0.17
141 0.21
142 0.24
143 0.28
144 0.31
145 0.33
146 0.39
147 0.38
148 0.36
149 0.34
150 0.37
151 0.36